KEGG   Streptomyces albus DSM 41398: SLNWT_6185Help
Entry
SLNWT_6185        CDS       T03823                                 

Definition
(GenBank) betaine aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals00010  Glycolysis / Gluconeogenesis
sals00053  Ascorbate and aldarate metabolism
sals00071  Fatty acid degradation
sals00280  Valine, leucine and isoleucine degradation
sals00310  Lysine degradation
sals00330  Arginine and proline metabolism
sals00340  Histidine metabolism
sals00380  Tryptophan metabolism
sals00410  beta-Alanine metabolism
sals00561  Glycerolipid metabolism
sals00620  Pyruvate metabolism
sals00625  Chloroalkane and chloroalkene degradation
sals00903  Limonene and pinene degradation
sals01100  Metabolic pathways
sals01110  Biosynthesis of secondary metabolites
sals01120  Microbial metabolism in diverse environments
sals01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sals00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLNWT_6185
   00053 Ascorbate and aldarate metabolism
    SLNWT_6185
   00620 Pyruvate metabolism
    SLNWT_6185
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SLNWT_6185
   00561 Glycerolipid metabolism
    SLNWT_6185
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLNWT_6185
   00310 Lysine degradation
    SLNWT_6185
   00330 Arginine and proline metabolism
    SLNWT_6185
   00340 Histidine metabolism
    SLNWT_6185
   00380 Tryptophan metabolism
    SLNWT_6185
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLNWT_6185
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SLNWT_6185
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SLNWT_6185
Enzymes [BR:sals01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SLNWT_6185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJE86561
UniProt: A0A0B5F6Q4
LinkDB All DBs
Position
7145684..7147072
Genome map
AA seq 462 aa AA seqDB search
MKAHDGMYIDGDWRPAAGTESLSVVNPADEQVIATVPAGTAEDIDTAVRAARAAFPAWAA
TPPAERAARLAALRDALAARKDEIAETVTAELGAPLAFSQSVHTGMPVAVAGSYAELAAG
YAFEEKVGNSTVLLEPVGVVGAITPWNYPLHQIVAKVAPALAAGCTVVLKPAEDTPLTAQ
LFTEAVHEAGVPAGVFNLVTGLGPVAGQALAEHEGVDLVSFTGSTAVGRQIGATAGGAVK
RVALELGGKSANVILPSADLAKAVNVGVANVMSNTGQTCSAWTRMLVHEDQYEQAVALAA
KAADKYGDRIGPVVNAKQHQRVRGYIEKGIAEGARLVTGGPEAPREQGYWVSPTVFAEVT
PEMTIAQEEIFGPVLSILKYRDEDEAVRIANGTVYGLAGAVWAADQEEAAAFARRLETGQ
VDINGGRFNILAPFGGYKQSGVGRELGGHGLSEYLQTKSLQF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgcacgacgggatgtacatcgacggggactggcggccggccgccggaaccgag
tcgctcagcgtcgtgaacccggccgacgagcaggtgatcgccacggtcccggccgggacc
gccgaggacatcgacaccgcggtacgcgcggcccgggccgccttcccggcctgggccgcc
accccgcccgcggagcgggccgcccgcctggccgccctgcgcgacgcgctcgccgcccgc
aaggacgagatcgccgagaccgtcaccgccgagctgggcgccccgctcgccttctcgcag
tcggtgcacaccgggatgccggtcgcggtggcgggctcgtacgccgaactcgcggccggg
tacgccttcgaggagaaggtcggcaactcgaccgtgctgctcgaaccggtgggcgtggtc
ggcgcgatcaccccctggaactacccgctgcaccagatcgtggccaaggtcgcccccgcc
ctcgccgcgggctgcaccgtggtcctcaagcccgccgaggacaccccgctgaccgcccag
ctcttcaccgaggcggtgcacgaggccggggtgccggcgggcgtcttcaacctggtcacc
gggctcggcccggtcgcggggcaggcgctggccgagcacgagggcgtggacctggtctcc
ttcaccggatcgaccgcggtcgggcggcagatcggcgccaccgcgggcggcgccgtcaag
cgggtcgccctcgaactcggcggcaagtccgccaatgtcatcctgccgagcgccgacctc
gccaaggcggtcaacgtcggcgtcgccaacgtcatgtccaacaccggccagacatgcagc
gcctggacccggatgctcgtccacgaggaccagtacgagcaggccgtggcccttgccgcg
aaggccgcggacaagtacggcgaccgcatcggcccggtggtcaacgccaagcagcaccag
cgggtgcgcggctacatcgagaagggcatcgcggagggcgcccgcctggtcaccggcggc
cccgaggcgccccgcgagcagggctactgggtgagccccacggtcttcgccgaggtgacc
cccgagatgaccatcgcccaggaggagatcttcggcccggtcctcagcatcctgaagtac
cgcgacgaggacgaggcggtacgcatcgccaacggcaccgtctacggcctcgccggggcg
gtctgggcggcggaccaggaggaggccgccgccttcgcgcggcgcctggagaccggccag
gtcgacatcaacggcggccgcttcaacatcctcgcccccttcggcggctacaagcagtcc
ggcgtcggccgcgaactcggcggccacggactcagcgagtacctgcagaccaagtcgctc
cagttctga

DBGET integrated database retrieval system