KEGG   Streptomyces albus DSM 41398: SLNWT_6214Help
Entry
SLNWT_6214        CDS       T03823                                 

Definition
(GenBank) class III aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals00250  Alanine, aspartate and glutamate metabolism
sals00410  beta-Alanine metabolism
sals00640  Propanoate metabolism
sals00650  Butanoate metabolism
sals01100  Metabolic pathways
sals01120  Microbial metabolism in diverse environments
Module
sals_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sals00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SLNWT_6214
   00650 Butanoate metabolism
    SLNWT_6214
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SLNWT_6214
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLNWT_6214
Enzymes [BR:sals01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SLNWT_6214
Amino acid related enzymes [BR:sals01007]
 Aminotransferase (transaminase)
  Class III
   SLNWT_6214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AJE86590
UniProt: A0A0B5F4R5
LinkDB All DBs
Position
7173458..7174765
Genome map
AA seq 435 aa AA seqDB search
MSGRPEELHARHRAVLPDWLALYYDRPIEITHGEGRHVWDAEGNRYLDFFGGILTTMTAH
ALPEVTKAVSEQAGRILHSSTLYLNRPMIELAERVARLSGIPDARVFFTASGTEANDTAL
MLATTHRRSNQILAMRNSYHGRSFSAVGITGNTAWSPTSLSPLQTLWVHGGVRSTGPFAE
LSDAEFTAACVADLEDLLGQAQSGVAALIAEPVQGVGGFTSGPDGLFAAFREVLDRHGIL
WISDEVQTGWGRTGEHFWGWQAHQENGPPDILTFAKGIGNGMSIGGVVARAEVMNSLGAN
SLSTFGGSPVTMAAGLANLSYLLEHDLQGNARRVGGLLIERLRAAAAGIAEVREVRGRGL
MIGIELTDPATGGPAPALAAAVLEAAREGGLLVGKGGGHHSSVLRVAPPLSLTVAEAEEG
GRILGEALRTATGGG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggcgcccggaggagctgcacgcgcgccaccgcgcggtcctgcccgactggctg
gcgctctactacgaccggccgatcgagatcacccacggcgagggccgccacgtctgggac
gccgagggcaaccgctacctcgacttcttcggcggcatcctcaccaccatgaccgcgcac
gcgctgcccgaggtcaccaaggcggtgagcgagcaggccggccggatcctgcacagctcc
accctctacctcaaccggccgatgatcgaactcgccgagcgcgtcgcccggttgtccggc
atcccggacgcgcgggtcttcttcaccgcctccggcaccgaggccaacgacaccgcgctg
atgctcgccaccacccaccggcgctccaaccagatcctggcgatgcgcaacagctaccac
ggccggtccttctccgccgtcggcatcaccggcaacaccgcctggtcgccgacgagcctg
tccccgctgcagaccctctgggtgcacggcggggtccgctccaccgggccgttcgccgag
ctgagcgacgcggagttcaccgccgcctgcgtcgccgacctggaggacctgctcggccag
gcgcagagcggggtcgccgccctcatcgcggagccggtgcagggcgtcggcggcttcacc
tccggccccgacgggctcttcgccgccttccgcgaggtcctcgaccggcacggcatcctg
tggatcagcgacgaggtgcagaccggctggggccgtaccggcgagcacttctggggctgg
caggcgcaccaggagaacggcccgccggacatcctcaccttcgccaagggcatcggcaac
ggcatgtccatcggcggcgtggtcgcccgcgccgaggtgatgaacagcctcggcgccaac
tccctctccaccttcggcggcagcccggtcaccatggccgcgggcctcgccaacctctcc
tacctcctggagcacgacctccagggcaacgcccgccgcgtcggcggactgctcatcgag
cggctgcgggcggcggcggccgggatcgccgaggtgcgggaggtacgcggccggggcctg
atgatcggcatcgagctgaccgacccggcgaccggcgggcccgcgcccgcgctcgccgcc
gcggtgctcgaagcggcccgcgagggcggactgctcgtcggcaagggcggcggccaccac
agcagcgtgctgcgggtcgcacccccgctcagcctcaccgtcgccgaggccgaggagggc
ggccggatcctcggcgaggccctgcgcaccgccaccgggggcggctga

DBGET integrated database retrieval system