KEGG   Streptomyces albus DSM 41398: SLNWT_6242Help
Entry
SLNWT_6242        CDS       T03823                                 

Definition
(GenBank) putative glycerol uptake facilitator protein
  KO
K02440  glycerol uptake facilitator protein
Organism
sals  Streptomyces albus DSM 41398
Brite
KEGG Orthology (KO) [BR:sals00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sals02000]
    SLNWT_6242
Transporters [BR:sals02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    SLNWT_6242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: AJE86618
UniProt: A0A0B5EUU1
LinkDB All DBs
Position
complement(7205534..7206322)
Genome map
AA seq 262 aa AA seqDB search
MSSSDIFTGEVIGTAVLILLGAGVCAAVTLKRSKAQNAGWLAITFGWGFAVLTGAYISAG
VSGAHLNPAVTLGLAIQGGTEWSDVPLYLASQLLGAMIGAALVWVAYYGQFRAHLSDPEI
VNTPGPEGMVDERLEPQAGPVLGIFSTGPEIRHAVQNLLTEIIATVVLVLAILTQGLNDE
GKGLGVLGVLITALVVVGIGLSLGGPTGYAINPVRDLGPRIVHALVPMANKGGSDWGYAW
IPVVGPLIGGALAGGLYELAFA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagctccgacatcttcaccggcgaggtcatcgggaccgccgtactcatcctgctc
ggcgccggcgtctgcgccgccgtcacgctcaagcgctcgaaggcacagaacgcgggctgg
ctcgccatcaccttcgggtggggcttcgcggtgctcaccggcgcctacatatcggccggt
gtctccggcgcccacctcaaccccgcggtcaccctcggtctcgccatccagggcggcacc
gagtggtccgacgtaccgctctacctggcctcgcagctgctcggcgcgatgatcggcgcc
gccctggtctgggtcgcctactacgggcagttccgcgcccacctctcggaccccgagatc
gtcaacaccccgggccccgagggcatggtcgacgagcgcctcgaaccccaggccggcccc
gtgctcggcatcttctccaccggtccggagatccggcacgctgtgcagaacctcctcacc
gagatcatcgcgaccgtggtcctggtcctggccatcctcacccagggcctcaacgacgag
ggcaagggcctcggcgtcctcggcgtcctcatcaccgccctcgtggtggtcggcatcggc
ctctcgctcggcggcccgaccgggtacgccatcaacccggtccgcgacctcggcccgcgc
atcgtgcacgccctggtccccatggccaacaagggcggctcggactggggctacgcctgg
atcccggtcgtcggcccgctcatcggcggcgccctggcgggcggactctacgagctcgcc
ttcgcctga

DBGET integrated database retrieval system