KEGG   Streptomyces albus DSM 41398: SLNWT_6891Help
Entry
SLNWT_6891        CDS       T03823                                 

Definition
(GenBank) betaine-aldehyde dehydrogenase
Organism
sals  Streptomyces albus DSM 41398
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh FAM25 SANTA
Motif
Other DBs
NCBI-ProteinID: AJE87267
UniProt: A0A0B5F9V8
LinkDB All DBs
Position
complement(7880896..7882350)
Genome map
AA seq 484 aa AA seqDB search
MTTIDYEQFYIDGGWTAPATDARITVRSATTEEVVGHVPEAGEKDIDLAVEAARRAFDDP
EGWPQWSPDRRSAVLERFAAALEKRGAETARRVTVQNGMPTAVAQQFEAGFPALLLRYYA
GLVAQTPQEEVRPGMLGGSSLVARQPVGVVAAIVPWNVPQGITFLKLAPALAAGCTVVLK
PAPETVLDAFLMAEAAVEAGLPAGVLNVVPGGREVGAHLVSHPKVDKVSFTGSTAAGRAI
AETCGRLLRPVTLELGGKSAAVVLDDADLASNLESFFAATLLNNGQICWLGTRVLAPRTR
YQEVVDTITGLVDSLAIGDPLDPATQLGPLVSARQRERVEGYIAKGVGDGARLTSGGKRP
SGIDKGWFVEPTVFADVNPASVIAQEEIFGPVLAVIPYADEDEAVAIANGTEYGLGGSVW
TADPDRGTAFARKVRTGTIGVNAYVNEPTAPFGGIKASGLGRELGPEGLAPFQVYKTVYL
DARA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccatcgactacgagcagttctacatcgacgggggctggacggcccccgcgacc
gacgccaggatcaccgtacggtcggcgaccaccgaagaggtggtcggccacgtccccgaa
gccggtgagaaggacatcgacctcgcggtcgaagcggcccgccgcgccttcgacgacccc
gagggctggccgcagtggtccccggaccgcaggtccgccgtgctggaacgcttcgcggcc
gcactggagaagcggggtgcggagacagcccggcgcgtgacggtgcagaacggcatgccc
accgccgtggcgcagcagttcgaagcaggtttccccgcactgctgctgcgctactacgcg
ggactggtcgcgcagacaccgcaggaggaggtcaggccggggatgctgggcggctcctcg
ctcgtcgcccggcagccggtgggagtggtggccgcgatcgttccgtggaacgtcccccag
ggcatcaccttcctcaagctggccccggcgctggccgcgggctgcacggtggtcctgaag
ccggcgcccgagacggtcctggacgccttcctcatggccgaggccgccgtggaggccggg
ctgcccgccggagtgctcaacgtggtcccgggcggacgggaggtcggggcccatctcgtc
tcccaccccaaggtggacaaggtgtccttcaccggatccaccgcggcgggacgggccatc
gcggagacctgcgggcggctgctgcgtcccgtgactctggagctgggcgggaagtccgcg
gcggtcgtgctcgacgacgcggatctggcctcgaatctggagagcttcttcgccgcgacg
ctgctcaacaacgggcagatctgctggctggggacccgggtgctcgccccgcgcacccgc
taccaggaagtcgtcgacaccatcacgggcctggtcgactcgctcgccatcggcgaccct
ctcgacccggccacccaactcggcccgctggtctcggcccggcagcgcgaacgggtcgag
ggctacatcgccaagggtgtcggcgacggcgcacggctcacctcgggagggaagcggccc
tcgggcatcgacaagggctggttcgtcgagccgacggtcttcgccgatgtgaaccccgct
tccgtcatcgcccaggaggagatcttcggcccggtactcgcggtgatcccctacgcggac
gaggacgaggcggtcgccatcgccaacggcacggagtacggcctgggcggctccgtatgg
acggccgatcctgaccgcggaacggccttcgcccgcaaggtgcgcaccggcaccatcggc
gtcaacgcctacgtcaacgagccgaccgctcccttcggcggcatcaaggcgagcggcctg
ggccgggaactgggccccgaggggctggcgcccttccaggtctacaagacggtgtacctc
gacgcgagggcgtag

DBGET integrated database retrieval system