KEGG   Streptomyces albus DSM 41398: SLNWT_7191Help
Entry
SLNWT_7191        CDS       T03823                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals00250  Alanine, aspartate and glutamate metabolism
sals00410  beta-Alanine metabolism
sals00430  Taurine and hypotaurine metabolism
sals00650  Butanoate metabolism
sals01100  Metabolic pathways
sals01110  Biosynthesis of secondary metabolites
sals01120  Microbial metabolism in diverse environments
sals02024  Quorum sensing
Module
sals_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sals00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SLNWT_7191
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SLNWT_7191
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLNWT_7191
   00430 Taurine and hypotaurine metabolism
    SLNWT_7191
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SLNWT_7191
Enzymes [BR:sals01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SLNWT_7191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJE87567
UniProt: A0A0B5FAS1
LinkDB All DBs
Position
8197264..8198730
Genome map
AA seq 488 aa AA seqDB search
MAPLSHGTPASRVQPELAVNPLHGAANPAAAMTESPPENRLPEAPLAPATAYQLVHDELM
LDGNARLNLATFVTTWMEPEAGLVMADCRDKNMIDKDEYPRTAELERRCVAMLADLWHAP
DPSAAVGCSTTGSSEACMLAGMALKRRWALRNADRYPGARPNLVMGVNVQVCWDKFCAYW
EVEARQVPMEGERFHLDPRAAAELCDENTIGVVGILGSTFDGSYEPIAELCTALDELQER
TGLDIPVHVDGASGAMIAPFLDQELLWDFRLPRVASVNTSGHKYGLVYPGVGWALWRDAE
ALPEELVFRVNYLGGDMPTFALNFSRPGAQVAAQYYMFLRLGREGYRAVQQATRDVARGL
AGRIGALGDFRLLTRGEELPVFAFTTAPDIRAYDVFDVSRRLREAGWLVPAYTFPAHRED
LAVCRVVCRNGFTSDLAALLLDDLGRVLPELREQPRPLVRDRGAETPFHHCEEAVPPPLA
EPSAPRFG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcacctctctcgcacggaacccccgcgagccgcgtccagcccgagctggccgtcaac
cccctgcacggcgcggcgaatccggccgccgcgatgaccgagtccccgcccgagaaccgc
ctgcccgaggcacccctcgcgcccgccaccgcataccagctggtgcacgacgaactcatg
ctggacggcaacgcgcggctgaacctggccaccttcgtcaccacctggatggagccggag
gccgggctggtgatggccgactgccgggacaagaacatgatcgacaaggacgagtacccg
cgcaccgccgaactggagcgccgctgcgtggccatgctcgccgacctgtggcacgccccc
gacccctcggccgccgtgggctgctcgaccaccggctccagcgaggcctgcatgctggcc
gggatggcgctcaagcggcgctgggcgctgcgcaacgccgaccgctacccgggcgcccgg
cccaatctggtgatgggcgtcaacgtccaggtgtgctgggacaagttctgcgcctactgg
gaggtggaggcccgccaggtccccatggagggcgagcggttccacctcgacccccgggcc
gccgccgagctgtgcgacgagaacaccatcggcgtcgtcggcatcctcggctccaccttc
gacggctcctacgagccgatcgccgagctgtgcaccgccctggacgaactccaggaacgc
accggcctcgacatccccgtgcacgtcgacggcgcctccggcgcgatgatcgcgcccttc
ctcgaccaggagctgctgtgggacttccggctgccgcgggtcgcctccgtcaacacctcc
ggtcacaaatacggactcgtctacccgggagtcggctgggccctgtggcgggacgccgag
gcgctgcccgaggagctggtcttccgcgtcaactacctcggcggcgacatgccgaccttc
gccctcaacttctcccgccccggcgcccaggtcgccgcgcagtactacatgttcctcagg
ctcggccgcgagggctaccgcgccgtccagcaggccacccgggacgtcgcccgcgggctc
gccgggcggatcggcgccctcggcgacttccgcctgctcacccggggcgaggagctgccg
gtcttcgccttcaccaccgcgccggacatccgcgcctacgacgtcttcgacgtgtcccgg
cggctgcgcgaggcgggctggctggtgcccgcctacaccttccccgcgcaccgggaggac
ctcgcggtctgccgggtggtgtgccgcaacggcttcacctccgacctcgcggcgctgctc
ctcgacgacctcggccgggtgctgcccgagctgcgcgagcagccccggcccctggtccgc
gaccggggcgcggagacccccttccaccactgcgaggaggccgtaccgcctccgcttgcg
gagccgtccgccccgcgtttcggttga

DBGET integrated database retrieval system