KEGG   Streptomyces albus DSM 41398: SLNWT_7268Help
Entry
SLNWT_7268        CDS       T03823                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain-containing protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sals  Streptomyces albus DSM 41398
Pathway
sals03030  DNA replication
sals03410  Base excision repair
sals03420  Nucleotide excision repair
sals03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sals00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SLNWT_7268
   03410 Base excision repair
    SLNWT_7268
   03420 Nucleotide excision repair
    SLNWT_7268
   03430 Mismatch repair
    SLNWT_7268
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sals03032]
    SLNWT_7268
   03400 DNA repair and recombination proteins [BR:sals03400]
    SLNWT_7268
Enzymes [BR:sals01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SLNWT_7268
    6.5.1.6  DNA ligase (ATP or NAD+)
     SLNWT_7268
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SLNWT_7268
DNA replication proteins [BR:sals03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SLNWT_7268
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SLNWT_7268
DNA repair and recombination proteins [BR:sals03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SLNWT_7268
   NER (nucleotide excision repair)
    Other NER factors
     SLNWT_7268
   MMR (mismatch exicision repair)
    Other MMR factors
     SLNWT_7268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AJE87644
UniProt: A0A0B5F0P3
LinkDB All DBs
Position
complement(8288273..8289808)
Genome map
AA seq 511 aa AA seqDB search
MLLAQLAQVSREVAGTPARSRKTALLAELFRAADPSEAPLVAAYLAGRLPQGRIGVGWSS
LKDPPPAASAPSLTVGAVDAALTALGEVSGAGSQAERRRLLGELMGAATEEEQRFLTGLL
TGEVRQGALDAVAAEGLAQAAGVPAAGVRRAVMLAGSLEPVAAAVLARGEEALTEFRLTL
GSPVQPMLARSAASVAQALDKLGPCAVEEKLDGIRVQVHRDGEGVRVYTRTLEEITARVP
ELTRAALELPKERFILDGEVIALDEERRPRSFQDIAGRVGSRSDVASAAAALPLSPVFFD
VLSLDGTDLLPLPLTERHTRLASLVPEEMRVRRLVLGAPGAADDRERAEEFLAQTLARGH
EGVVVKGLDAAYSAGRRGASWLKVKPVRTLDLVVLAAEWGHGRRTGKLSNLHLGARREDG
TYAMLGKTFKGLTDALLDWQTERLGELATSDDGHVVRVRPELVVEIAYDGLQRSSRYPAG
VTLRFARVVRYREDKPAAEADTVDTVLAAGA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcgcacagctggcccaggtttcccgggaggtcgccggtactcccgcgcggtcc
cgtaagaccgcgctgctcgccgagctgttccgggccgcggacccgtccgaggctcctctg
gtggccgcctatctggcggggcggctgccgcagggccggatcggcgtcggctggagcagc
ctcaaggacccgccgcccgcggcctcggcgccgagcctgacggtcggggcggtggacgcc
gccctgaccgcgctcggcgaggtctccggcgccggttcgcaggccgaacgcaggcgcctg
ctgggcgagttgatgggcgccgcgaccgaggaggagcagcgcttcctgaccgggctgctg
accggcgaggtccgccagggcgccctggacgcggtggccgccgagggactggcgcaggcg
gcgggggtgcccgcggccggggtgcgccgggccgtgatgctggccggttccctggagccg
gtcgcggcggcggtgctggcgcggggcgaggaggcgctcacggagttccgcctgacgctg
ggcagcccggtgcagccgatgctcgcccgcagcgccgcctcggtcgcccaggcgctggac
aagctcggcccctgcgccgtcgaggagaagctcgacggcatccgcgtacaggtgcaccgg
gacggcgagggggtgcgcgtctacaccaggaccctggaggagatcaccgcccgggtgccc
gaactgacccgcgccgcactggagttgccgaaggagcggttcatcctggacggggaggtc
atcgccctggacgaggagcggcggccgcgctccttccaggacatcgcgggccgggtgggc
tcccgctccgatgtcgcctccgccgcggccgccctcccgctgagccccgtcttcttcgac
gtcctctccctggacggcaccgacctgctcccgctgccgctcaccgaacggcacacccgg
ctcgcctcgctcgtccccgaggagatgcgggtacgccgcctggtgctcggcgcaccgggg
gcggcggacgaccgggagcgcgccgaggagttcctcgcgcagaccctggcccggggccac
gagggcgtggtggtcaagggcctcgacgccgcgtacagcgcgggccgccgcggcgcctcc
tggctgaaggtgaagcccgtacgcaccctcgacctggtggtcctggccgccgagtggggc
cacgggcggcgcaccgggaagctgtccaatctgcatctgggcgcgcggcgcgaggacggt
acgtacgccatgctcgggaagaccttcaaggggctgacggacgcgctgctcgactggcag
accgagcggctcggggagctggccacctcggacgacgggcacgtggtgcgggtgcggccc
gagctggtggtggagatcgcctacgacggcctccagcgctccagccgctatccggccggg
gtgacgctgcgcttcgcgcgcgtggtgcgctaccgcgaggacaagccggcggccgaggcg
gacaccgtggacacggtgctcgcggccggtgcctga

DBGET integrated database retrieval system