KEGG   Salegentibacter sp. T436: AO058_02240Help
Entry
AO058_02240       CDS       T04614                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
salt  Salegentibacter sp. T436
Pathway
salt00564  Glycerophospholipid metabolism
salt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AO058_02240
Enzymes [BR:salt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AO058_02240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 HI0933_like Pyr_redox_3 NAD_binding_8 FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: APS37770
UniProt: A0A1L6QZW2
LinkDB All DBs
Position
520916..522559
Genome map
AA seq 547 aa AA seqDB search
MKKTNTRENSDNDSFKRDHILSKLDLSKIWDVIIIGGGATGLGTALDASSRGLKTLLLEQ
ADFANGTSSRSTKLVHGGVRYLAQGNLGLVMDALKERGLMIKNAPHLVKMLPFIIPSYKA
WDKYYYGIGLKIYDWMAKSLRFQKTKFLNREETLSHLPNINKKNLNGGVLYFDGQFDDTR
LAINLAQSAAEQGANLLNYFEVTELSKDENKKITGVKAKDIESGNVYNFKSKVVINATGV
FVDNILKMNDSSKIPLVKASQGIHLVLDKSFMKSDHALMIPSTSDGRVLFALPWHDHLLV
GTTDTPVEQHLLEPSALDSEIDFILNNLEEYLTRKPSKKDILSVFAGLRPLVQPNKDKGT
KEISRDHKLTVSRSNLITITGGKWTTYRKMAEDTVDFAIETGNLKKSPSKTDHLKIHGAT
QKVTGNHLDIYGSDADLIMKLAEENPKLQERLNPEFPVLKAEVVWAAKYEMARTIEDFLA
RRTRLLFLDARAAIDAAEETAIIMADVLGKDSSWQNHQIKNFIKMAQNYLPEPYNPVNRK
SQEIETK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaaatactcgtgagaattcggataatgattcttttaaaagagatcacata
ctttctaaattagacctttctaaaatttgggatgtaataattattggcggaggggcaaca
ggactggggacagctctggatgccagctcaagaggccttaaaacattacttttagagcag
gcagacttcgcaaatgggacgtcgagtagaagcacaaagcttgtacatggaggagtaaga
tatctagcgcagggaaacttaggcttagttatggatgccctgaaagagagagggctaatg
attaagaatgcacctcatcttgtaaaaatgctaccttttataattccaagctataaagcc
tgggacaagtattattatggaattggcttgaagatttatgattggatggcaaaaagttta
agatttcaaaaaactaaattcttgaacagagaggaaactttaagccatttaccaaacata
aataaaaaaaaccttaatggaggagtgctttatttcgatgggcagtttgacgatacacgt
cttgcaataaatttagcccaaagtgcagctgagcaaggggccaatcttcttaattacttt
gaagtaaccgaacttagcaaggatgaaaacaaaaaaataacgggtgtaaaagcaaaagat
atcgaaagcggcaacgtgtataattttaaatcgaaagttgtcatcaatgccacgggggtt
tttgtagataacattcttaagatgaatgattcttcgaaaatcccgttagttaaggcaagc
cagggaattcatttagtgttagataaatcttttatgaaaagtgatcacgcgctaatgatt
ccttcaacttcagatggaagagtattgtttgcactgccgtggcacgaccatcttcttgta
ggaactaccgacacccctgtagaacagcaccttttggaaccaagtgcccttgatagtgaa
atagactttatattaaacaatcttgaagaatacctaaccaggaaaccatctaagaaagat
attttaagtgtgtttgcgggtttgagaccattagtgcagcctaataaagacaaaggaact
aaagaaatttccagagatcataaactaacggtttccagatctaaccttataacgattacc
gggggaaaatggactacctatcgtaaaatggctgaagacaccgttgatttcgctattgaa
acggggaatttgaaaaaatcacccagtaaaactgatcatttaaaaatacacggtgctacc
cagaaagtaacggggaatcatctagatatttacggtagtgatgcagacttaattatgaaa
ttagccgaggagaatccaaaactacaggaacgacttaacccagaatttccagttctgaaa
gctgaagtggtatgggcggcaaagtatgagatggccagaacaatagaagattttttagcc
agaagaacgcgtttgttatttttggatgcaagagcagctattgatgcagctgaagaaacg
gcaataatcatggctgatgttttaggaaaagattcttcctggcaaaatcaccagataaaa
aatttcattaaaatggcacaaaattacttacccgaaccttataacccagtaaatagaaaa
tcccaagaaatagaaaccaaataa

DBGET integrated database retrieval system