KEGG   Salegentibacter sp. T436: AO058_09320Help
Entry
AO058_09320       CDS       T04614                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
salt  Salegentibacter sp. T436
Pathway
salt00380  Tryptophan metabolism
salt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AO058_09320
Enzymes [BR:salt01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AO058_09320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: APS39057
UniProt: A0A1L6R3E4
LinkDB All DBs
Position
2108660..2109967
Genome map
AA seq 435 aa AA seqDB search
MQFQNTLEYARELDSQDKIASYRDQFIFPQHEGKNVIYFTGNSLGLQPKSAKKYVDEIMT
DWANLAVEGHFYAEKPWWDYHERFSEKLAKVVGAKPAEVTVMNTLTVNLHLLMVSFYRPE
GKRYKIICEEKAFPSDQYMISSQVRFHEYDPKDAIVEIRRRDGENNFRTEDIIAKINEVG
EECALVLIGGVNYYTGQVLEMEKITKAGHEVGAFVGWDLAHAAGNIELKLSEWKVDFAAW
CSYKYMNSGPGNASGCFINEKYHNQKDIPRFEGWWGHNKERRFLMEPEFQPENGADAWQI
SNAPVLALAPYLASLEMFDEVGMPALIEKRNKIVAYLEFVLHEIDKEVESSFEIITPSNQ
EERGTQLSVFLHGEGRELFNYLMENGVITDWREPNVIRLAPAPFYCSFEDMYQFGQILKN
GILKKTKEDRVSKRD
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttcaaaatacacttgaatatgcccgggaactggattcccaggataaaatagca
tcatatcgtgaccaatttattttcccacagcacgaagggaaaaatgtgatttatttcacc
ggaaattcacttggtcttcaaccaaaatcagcaaaaaaatatgtagacgaaataatgacc
gattgggcaaatcttgccgtagaaggtcatttctatgccgaaaaaccctggtgggactat
cacgaaaggttttcagaaaaactagctaaagttgttggtgctaaaccagctgaggttacg
gtaatgaatacccttacggtaaacctgcatttactaatggtttccttttatagacctgaa
ggaaaacgctataaaattatatgtgaagaaaaagcttttcccagtgaccagtatatgatc
tcgagccaggtgcgttttcacgagtatgatcccaaagacgctattgttgaaattagaagg
cgcgatggtgaaaataattttagaactgaagatattatagcaaagatcaatgaagtagga
gaggagtgcgctttggttttaattgggggtgtaaattactatactggacaggttttagag
atggaaaaaatcacaaaagcgggacacgaagttggcgcttttgtaggttgggatcttgcc
cacgccgccggaaatattgagcttaaacttagtgagtggaaggttgattttgctgcctgg
tgcagttataaatatatgaatagtggtccgggaaatgcttccggatgttttataaatgaa
aaatatcacaaccaaaaagacattccgcgttttgaaggctggtggggacataacaaagaa
cgtcgctttttaatggaaccagaatttcaacccgaaaacggtgccgatgcctggcaaatt
tctaatgccccggttttggcacttgcaccatatttggcttcgttagaaatgtttgatgaa
gtgggaatgccggctttaatagaaaaacgaaataagatcgttgcgtaccttgaatttgtt
ttacacgaaattgacaaggaagtggagagtagttttgaaataattactccttcgaatcag
gaagagcgcggtacccagctttcggtatttttacacggggaaggaagggaattatttaat
tatttaatggaaaacggcgtaataactgactggcgagaaccgaatgtaatcaggctggct
ccagcaccattttattgttcttttgaagatatgtaccaatttgggcaaattttgaagaat
ggaattcttaaaaagaccaaagaagatagagtttcgaaaagagattaa

DBGET integrated database retrieval system