KEGG   Streptomyces albulus NK660: DC74_1434Help
Entry
DC74_1434         CDS       T03082                                 

Definition
(GenBank) putative glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
salu  Streptomyces albulus NK660
Pathway
salu00250  Alanine, aspartate and glutamate metabolism
salu00410  beta-Alanine metabolism
salu00430  Taurine and hypotaurine metabolism
salu00650  Butanoate metabolism
salu01100  Metabolic pathways
salu01110  Biosynthesis of secondary metabolites
salu01120  Microbial metabolism in diverse environments
salu02024  Quorum sensing
Module
salu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:salu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    DC74_1434
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DC74_1434
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DC74_1434
   00430 Taurine and hypotaurine metabolism
    DC74_1434
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    DC74_1434
Enzymes [BR:salu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DC74_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIA01950
UniProt: A0A059VX09
LinkDB All DBs
Position
complement(1644943..1646391)
Genome map
AA seq 482 aa AA seqDB search
MPLKRPHQHRDASRNLAVNPVFSQQPVHVPRYELPGDGMDPDTAYQIVHDELMLDGNARL
NLATFVSTWAEPQAQRLMAECAEKNMIDKDEYPQTAEIEARCVHMLADLWHAPDSHAAVG
CSTTGSSEAAMLAGLALKRRWQHRRRAEGKSTERPNMVMGINVQICWEKFANYFEVEPRY
VPMEGDRFILSPEEAVELCDENTIGVVAVLGSTFDGAYEPVAKISAALDALQERTGIDVP
LHVDGASGAMIAPFLDPELVWDFRLPRVASINTSGHKYGLVMPGVGWALWRDADALPEDL
VFHVNYLGGDMPTFALNFSRPGAQVIAQYYNFLRLGFEGYRAVQQTSRDVATRVAAEIAA
MGPFTLLTDGSQLPVFAFRMSDDVTNFTVFDVSAALRERGWQVPAYTFPANRTDLAALRV
VIRNGFGHDLGDLFLDDLRRVLPRLQAQQRPHRDAADAGGFAHGAETKQAGRPAIPEQAV
RD
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgccactcaagcgcccgcaccagcaccgcgacgccagccgcaacctcgccgtcaacccg
gtcttcagccagcagccggtccacgtcccccggtacgagttgccgggcgacggcatggat
cccgacaccgcgtaccagatcgtccacgacgaactcatgctggacggcaacgcccggctg
aacctcgccaccttcgtcagcacctgggccgaaccgcaggcccagcgcctgatggccgag
tgcgccgagaagaacatgatcgacaaggacgagtacccgcagaccgccgagatcgaggcg
cgctgcgtgcacatgctcgccgacctgtggcacgcccccgactcccatgcggcggtgggc
tgttcgaccaccgggtccagcgaggcggcgatgctcgccgggctcgcgctcaagcgccgc
tggcagcaccgccggcgcgccgagggcaagtccaccgagcgtcccaacatggtgatgggc
atcaacgtccagatctgctgggagaagttcgccaactacttcgaggtcgagccgcgctac
gtgcccatggagggcgaccgcttcatcctctccccggaggaggccgtcgaactctgcgac
gagaacaccatcggcgtcgtcgccgtcctcggctccaccttcgacggcgcctacgagccg
gtcgccaagatctccgccgccctcgacgccctccaggagcgcaccggcatcgacgtcccg
ctgcacgtcgacggcgcctccggcgcgatgatcgcccccttcctcgaccccgaactcgtc
tgggacttccgcctcccgcgggtcgcctccatcaacacctccggccacaagtacggcctg
gtgatgcccggcgtcggctgggcgctgtggcgggacgccgacgcgctccccgaggacctg
gtcttccacgtcaactacctgggcggcgacatgcccaccttcgcgctgaacttctcccgg
cccggcgcccaggtcatcgcccagtactacaacttcctgcgcctgggcttcgaggggtac
cgcgccgtccagcagaccagccgggacgtcgccacccgggtcgccgccgagatcgccgcc
atggggccgttcaccctgctcaccgacggcagccagctccccgtcttcgccttccggatg
agcgacgacgtcaccaacttcaccgtcttcgacgtctccgccgcgctccgcgaacgcggc
tggcaggtccccgcctacaccttcccggccaaccgcaccgacctggccgccctgcgcgtc
gtgatccgcaacggtttcggccacgacctcggcgacctcttcctggacgacctgcggcgg
gtcctgccgcgcctccaggcccagcagcgtccgcaccgcgacgccgccgacgccggcggc
ttcgcccacggcgccgagaccaagcaggccggccgcccggccatcccggagcaggcggtc
cgcgactga

DBGET integrated database retrieval system