KEGG   Streptomyces albulus NK660: DC74_2802Help
Entry
DC74_2802         CDS       T03082                                 

Definition
(GenBank) oxidoreductase
Organism
salu  Streptomyces albulus NK660
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AIA03302
UniProt: A0A059W638
LinkDB All DBs
Position
complement(3175444..3176895)
Genome map
AA seq 483 aa AA seqDB search
MGDLVEHGKLYIGGEWVDPAGPDTIEVVSPHTERVIGRVPHAARADVDRAVAAARASFAS
GVWADAPLDERIAVVTRIKDAFAVRSEEFARVIGAQNGTPVTSGVMVQSLAAMMVWDATL
TVAREFAFEERRAGALGPLLVRREPVGVVAAVVPWNVPQFTAAAKLAPALLAGCSVVLKV
SPETPLDAYLLAEIASEAGVPPGVLSILPADREVSEYLVGHPGVDKVSFTGSVAAGRRVM
EVAARNLTRVTLELGGKSAAVILPDADLDAAVAGIAPFAWMINGQACVAQTRILAPRSRY
DEIAERFAAAAGALVVGDPLDPATELGPLVARRQQQRSLDYIALGQQEGAKVLAGGGRPK
GQPTGWYVEPTLFGEVDNGMRIAREEIFGPVICLLPYGDEAEAVRIANDSEYGLSGSVWT
ADTDRGIDLARRVRTGTYSVNTFSIDMLGPFGGYKNSGIGREFGPEGFAEYLEHKMIHLP
AGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacctcgtcgagcacggaaagctctacataggcggtgagtgggtcgatccggcc
ggaccggacacgatcgaggtcgtctcgccgcacaccgaacgggtcatcggccgggtcccg
cacgccgcgcgggccgacgtcgaccgggcggtggccgcggcccgggcgtccttcgcgtcc
ggggtgtgggccgatgccccgctggacgagcggatcgcggtggtgacccgcatcaaggac
gcgttcgcggtgcgcagcgaggagttcgcgcgggtcatcggcgcgcagaacgggacgccg
gtcacctcgggcgtgatggtgcagtcgctggccgcgatgatggtgtgggacgcgacgctc
accgtggcgcgggagttcgccttcgaggagcggcgggccggggcgctggggccgctgctg
gtgcgccgcgagccggtgggggtggtcgcggccgtcgtgccctggaacgtcccgcagttc
accgccgccgccaaactcgcgccggcgctgctggccgggtgctcggtggtgctgaaggtc
tcgccggagaccccgttggacgcgtacctgctcgcggagatcgcctcggaggccggcgtg
ccgccgggggtgctgtcgatcctgccggccgaccgggaggtcagcgagtacctggtcggg
cacccgggcgtggacaaggtgtcgttcaccggctcggtggcggccggcaggcgggtcatg
gaggtcgccgcccgcaacctcacccgggtgacgctggagttgggcggcaagtcggcggcg
gtgatcctgccggacgcggacctggacgcggcggtggccggcatcgcgccgttcgcgtgg
atgatcaacggccaggcgtgcgtggcgcagacccggatcctcgcgccgcgcagccgttac
gacgagatcgccgagcggttcgcggcggcggcgggcgcgctcgtcgtcggcgatccgctg
gacccggccacggaactcggaccgctggtcgcccgccgtcagcagcaacgctccctggac
tacatcgcgttgggccagcaggagggcgccaaggtgctggccggcggcggccgcccgaag
gggcagccgaccgggtggtacgtcgagccgacgctcttcggggaggtcgacaacgggatg
cggatcgcccgggaggagatcttcggcccggtcatctgcctgctgccgtacggggacgag
gcggaggcggtgcggatcgccaacgactcggagtacgggctgtcgggctcggtgtggacc
gcggacaccgaccgcggcatcgacctcgcgcgacgggtgcgcaccgggacgtactcggtg
aacaccttcagcatcgacatgctcggtccgttcggcggctacaagaactccggcatcggc
cgggagttcgggcccgaggggttcgccgagtacctggagcacaagatgatccacctgccg
gcgggtgcctga

DBGET integrated database retrieval system