KEGG   Streptomyces albulus NK660: DC74_5417Help
Entry
DC74_5417         CDS       T03082                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
salu  Streptomyces albulus NK660
Brite
KEGG Orthology (KO) [BR:salu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DC74_5417
Enzymes [BR:salu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DC74_5417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: AIA05877
UniProt: A0A059WDF6
LinkDB All DBs
Position
complement(6132334..6132729)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKYQGNEDADFRTRAVLIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSNDPATGQKALDLIAQ
IDKIFWETKKG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgcctgttcgcccccaaggtcaaggtcagcgcccactgcgacctgccctgc
ggtgtctacgaccccgcccaggcccgcatcgaggccgagtcggtcaaggccgtccaggag
aagtaccagggcaacgaggacgctgacttccgcacccgcgccgtcctgatcaaggagcag
cgggccgagctggccaagcaccacgtctcggtgctgtggagcgactacttcaagccgccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctcaaggccctcagc
gcggccaagggctcgaacgacccggccaccggccagaaggccctggacctgatcgcccag
atcgacaagatcttctgggagacgaagaagggctga

DBGET integrated database retrieval system