KEGG   Streptomyces albulus NK660: DC74_6447Help
Entry
DC74_6447         CDS       T03082                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
salu  Streptomyces albulus NK660
Pathway
salu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:salu00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    DC74_6447
Enzymes [BR:salu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DC74_6447
DNA repair and recombination proteins [BR:salu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     DC74_6447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AIA06882
UniProt: A0A059WGB4
LinkDB All DBs
Position
complement(7362663..7363643)
Genome map
AA seq 326 aa AA seqDB search
MAPTPGGGGAAPPLYPVIRPMLAVLGPLPPEHEQADWAFEAKWDGARCLVNAPGDGTIRL
VTRAGNDATTTYPELGPLGQQLRGRPAVLDGEVVVLDPSGRPDFGLLQRRMGVLNPRRTA
RLAMELPAQLVLFDVMYLAGPLVDAPYHARRAVLEGLGLAGPNWSVPGYLAGHGDRAWQA
ALRGGLEGVVAKRLSSPYLPGVRSPDWVKTKHVESLDVVIGGWTEGHGALGGLPGSVLAG
VVEPGGLRFVGAVGSGLSDAERRELASYLGVIPLDRSPFVNPVDQTGVHWTEPRLVAEIT
FSGWTSAGRIRHPVWHRLRPDLTRLG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggccccgacccccgggggcggcggcgcggccccgcccctgtatcccgtgatccggccg
atgctggccgtgctcgggccgctgccgcccgagcacgagcaggccgactgggcgttcgaa
gccaagtgggacggggcccggtgcctggtcaacgcgcccggcgacggcacaatccggctg
gtcacccgggccggcaacgacgccaccaccacctacccggagctggggccgctcgggcag
cagttgcgcgggcgccccgccgtgctggacggcgaggtggtggtgctggacccgtccggg
cggccggacttcgggctgttgcagcgtcggatgggcgtgctcaacccgcgccgcaccgcc
cggctggcgatggagttgccggcgcagctggtgctgttcgacgtgatgtacctggccggg
ccgctggtggacgcgccgtaccacgcgcggcgggcggtcttggagggcctggggctggcc
ggccccaactggtcggtgccggggtacctggccggccacggcgaccgggcgtggcaggcg
gcgctgcgcggcggcctggaaggcgtggtggccaagcggctgtcctcgccgtacctcccc
ggggtgcgctcgcccgactgggtcaagaccaagcacgtggagtcgctggacgtcgtcatc
ggcggctggacggaggggcacggggcgctcggcgggctgcccgggtcggtgctggcgggc
gtggtggaaccgggtgggctgcggttcgtgggcgccgtcgggtcgggcctgtccgacgcc
gagcgacgggaactggcgagctacctcggcgtgatcccgctggaccgctcgccgttcgtc
aaccccgtggaccagacgggggtgcactggacggaaccccggctggtggccgagatcacc
ttcagcggctggacctcggcgggccggatccggcatccggtctggcaccggctgcggccc
gacctgacccggctgggctga

DBGET integrated database retrieval system