KEGG   Streptomyces albulus NK660: DC74_6880Help
Entry
DC74_6880         CDS       T03082                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
salu  Streptomyces albulus NK660
Pathway
salu00220  Arginine biosynthesis
salu00250  Alanine, aspartate and glutamate metabolism
salu00290  Valine, leucine and isoleucine biosynthesis
salu01100  Metabolic pathways
salu01110  Biosynthesis of secondary metabolites
salu01130  Biosynthesis of antibiotics
salu01210  2-Oxocarboxylic acid metabolism
salu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:salu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DC74_6880
   00290 Valine, leucine and isoleucine biosynthesis
    DC74_6880
   00220 Arginine biosynthesis
    DC74_6880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:salu01007]
    DC74_6880
Enzymes [BR:salu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     DC74_6880
    2.6.1.66  valine---pyruvate transaminase
     DC74_6880
Amino acid related enzymes [BR:salu01007]
 Aminotransferase (transaminase)
  Class I
   DC74_6880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Death_2
Motif
Other DBs
NCBI-ProteinID: AIA07312
UniProt: A0A059WHJ4
LinkDB All DBs
Position
complement(7842381..7843592)
Genome map
AA seq 403 aa AA seqDB search
MQFKQSSKMADVCYEIRGPVIEHANALEEAGHSVLRLNTGNPALFGFECPEEILQDVMRN
LSRAHGYTESRGILAARRAVAQRYQEAGLPDVDVDDVYLGNGVSELVSMAIQALLDDGDE
VLIPAPDFPLWTAVTSLAGGKPVHYVCDEGADWLPDLDDLASKITDRTRALVIINPNNPT
GAVYPREVLEGMLDLARRHQLMVFADEIYDRILYDDAVHHHAAVLAPDLVCLTFSGLSKS
YRVAGFRSGWLVVSGPKEHAADYLEGLDTLASMRLCPNAPAQYAIQAALGGRQSIEDLVL
PGGRLREQRDRAWERLNEIPGVSCVKPKGALYAFPRLDPAVHKIHDDEKFVLDLLLREKI
QVVQGTGFNWPRPDHFRILTLPHADDLDAAISRIGRFLAGYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcaagcagtccagcaagatggccgacgtctgctacgagatccgcggaccggtg
atcgagcacgcgaacgcgctggaggaggccggccacagcgtcctgcggctgaacaccggc
aatccggcgctgttcggcttcgagtgcccggaggagatcctccaggacgtgatgcgcaac
ctctcccgtgcacacggctacaccgagtcccgcggcatcctggcggcccgccgcgcggtg
gcccagcgctaccaggaggccgggctgcccgacgtcgacgtcgacgacgtctacctgggc
aacggcgtctccgaactggtctcgatggcgatccaggcactgctggacgacggggacgaa
gtcctcatcccggcgcccgacttcccgctgtggacggcggtcacctcgctcgccggcggc
aagccggtgcactacgtctgcgacgagggcgccgactggctgccggacctcgacgacctg
gcctcgaagatcaccgaccggacccgcgccctggtgatcatcaaccccaacaaccccacc
ggtgcggtctatccgcgcgaggtgctggagggcatgctcgacctggcccgccgccaccag
ctgatggtcttcgccgacgagatctacgaccggatcctctacgacgacgccgtgcaccac
cacgccgcggtcctcgcaccggacctggtgtgcctgaccttcagcggactgtccaagtcg
taccgggtggccggcttccggtccgggtggctggtggtgtccggtcccaaggagcacgcg
gcggactacctggagggactggacaccctggcgtcgatgcgcctgtgtcccaacgccccc
gcgcagtacgccatccaggcggcgctcggcggccggcagagcatcgaggacctggtcctg
cccggtggccgcctgcgggagcagcgcgaccgggcctgggagcggctcaacgagatcccg
ggcgtctcctgcgtcaagcccaagggcgcactgtacgcattcccccgcctcgaccccgcg
gtccacaagatccacgacgacgagaagttcgtgctcgacctgctgctgcgggagaagatc
caggtcgtccagggcaccggcttcaactggccgcgcccggaccacttccggatcctcacc
ctcccgcacgccgacgacctggacgcggcgatcagccggatcgggcggttcctggccggc
taccggcagtag

DBGET integrated database retrieval system