KEGG   Streptomyces albulus NK660: DC74_7121Help
Entry
DC74_7121         CDS       T03082                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
salu  Streptomyces albulus NK660
Pathway
salu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:salu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    DC74_7121
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:salu03400]
    DC74_7121
Enzymes [BR:salu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DC74_7121
DNA repair and recombination proteins [BR:salu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     DC74_7121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AIA07549
UniProt: A0A059W7U6
LinkDB All DBs
Position
8103712..8104617
Genome map
AA seq 301 aa AA seqDB search
MSPITVVEGRRLSLTNLDKVLYPETGTTKGEVLHYCTTTADVLLPHLHDRPVSFLRYPDG
PDGQRFFTKNVPPGAPSWVKSCEVPHSRSGPARQVLLQDLASLVWAANLVVELHTPQWTC
GAPGVADRLVFDLDPGAPATIVECCTAARWLRDRLAADGLDAYAKTSGSKGLHLVVPIEP
TPADRTTAYARTLAVEAGVALGELVTHKMTRALRPGKVFIDFSQNAAAKTTATAYTLRAR
PLPTVSTPVTWDEVAACTQPGQLTFLFGEIAGRRARYGDLHAPLLGAERARPVPRGARRS
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgatcaccgtcgtggaggggcggcgcctctcgctgacgaacctggacaaggtc
ctctatcccgagaccggcaccaccaagggtgaggtgctgcactactgcaccaccaccgcg
gacgtgctgctcccgcacctccacgaccgtccggtgtccttcctgcgctaccccgacggg
ccggacggccagcgcttcttcaccaagaacgtgccgcccggcgcgccctcctgggtgaag
agctgcgaggtaccccattcgaggtcggggccggcccggcaggtgctcctccaggacctc
gcctcgctggtctgggccgccaacctcgtcgtcgaactgcacaccccgcaatggacctgc
ggcgcgccgggcgtggccgaccgactggtcttcgacctggatccgggcgcccccgccacc
atcgtggagtgctgcaccgccgcccggtggttgcgcgaccggttggcggcggacggcctc
gacgcctacgccaagaccagcggttccaaggggctgcacctcgtcgtgcccatcgagccc
acccccgccgaccgcaccaccgcctacgcccggacgctggcggtcgaggccggcgtcgcc
ctcggcgagctggtcacgcacaagatgacccgggcgctgcggccgggcaaggtcttcatc
gacttctcgcagaacgccgcggccaagaccaccgcgaccgcctacacgctgcgggcccgc
cccctgccgaccgtgtccacccccgtcacctgggacgaggtcgccgcctgcacccagccg
ggccaactcaccttcctcttcggcgagatcgccggtcgccgcgcgcgctacggggacctg
cacgcaccactgctcggcgcagaacgggcccgcccggtaccgcgcggcgcccgccggtcc
gcgtag

DBGET integrated database retrieval system