KEGG   Streptomyces albulus NK660: DC74_7353Help
Entry
DC74_7353         CDS       T03082                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
salu  Streptomyces albulus NK660
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C FANC_SAP
Motif
Other DBs
NCBI-ProteinID: AIA07775
UniProt: A0A059WDE4
LinkDB All DBs
Position
complement(8329473..8330540)
Genome map
AA seq 355 aa AA seqDB search
MDLPVMPPVSPMLAKPVAKIPAGMQYEAKWDGFRVLVFRDGDEVELASRTTKSLSRYFPE
LLTAVRSELPPRCVLDGEIVIAHDGRLHFEELLERIHPAASRVRTLAARTPASLIAFDLL
ALDSASLLAEPQTARRQALVEALRPARAPVHTAPATTDRELAQRWFGQFEGAGLDGVIAK
PLDLPYRPGERVLYKVKHARTADCVVAGYRLHKSGPVVGSLLLGLHDDAGHLQHVGVCAS
FPMARRRALVEELAPLRMADDETAGHPWGDWAEGAAHASRRMPGGPSRWSGGKDLSWVAL
RPELVCEVGYDHMEGSRFRHTAQFRRWRPDRTPGSCTYAQLEEPVGYDLGELLGD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtgatgcccccggtctcccccatgctcgccaaaccggtggcgaagatc
cccgccggaatgcagtacgaggccaagtgggacggcttccgcgtcctcgtcttccgggac
ggcgacgaggtcgaactcgccagccgcaccaccaagtcgctcagccgctacttccccgaa
ttgctgacggcggtccgcagcgaactgccgccgcgctgcgtgctcgacggcgagatcgtg
atcgcgcacgacggccggctgcacttcgaggagctgttggagcgcatccacccggccgcg
tcccgggtgcggacgctggccgcccgcacgcccgcctcgctgatcgccttcgacctgctg
gcgctggactccgcgtcgctgctggccgaaccgcagacggcccgccgccaggccctggtc
gaggcgctgcgtccggcccgggccccggtgcacaccgcgcccgccaccaccgaccgggag
ctggcgcagcggtggttcggccagttcgagggggccggactggacggggtgatcgccaag
ccgctggacctgccgtaccggccgggcgagcgcgtgctgtacaaggtcaagcacgcccgc
accgccgactgcgtggtcgccggctaccgcctgcacaagagcgggccggtggtcggctcg
ctgctgctcggactgcacgacgacgcggggcacctccagcacgtcggggtgtgcgcgtcg
tttcccatggcccggcggcgcgccctggtcgaggagctggcgccgctgcggatggccgac
gacgagaccgccggccacccttggggcgactgggcggagggggcggcgcacgcctcccgc
cggatgccgggcggaccgagccgctggagcgggggcaaggacctgtcgtgggtggcgctg
cggccggagctggtgtgcgaggtgggctacgaccacatggagggcagccggttccggcac
accgcgcagttccgccgctggcggcccgaccggacgccggggagctgcacctacgcgcag
ttggaggagccggtcggctacgacctgggggagctgctgggcgactga

DBGET integrated database retrieval system