KEGG   Streptomyces albulus NK660: DC74_839Help
Entry
DC74_839          CDS       T03082                                 

Definition
(GenBank) serine protease P80
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
salu  Streptomyces albulus NK660
Brite
KEGG Orthology (KO) [BR:salu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:salu01002]
    DC74_839
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salu04147]
    DC74_839
Enzymes [BR:salu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     DC74_839
Peptidases [BR:salu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   DC74_839
Exosome [BR:salu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DC74_839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-ProteinID: AIA01361
UniProt: A0A059W0J0
LinkDB All DBs
Position
881961..882776
Genome map
AA seq 271 aa AA seqDB search
MAGAWLRGGAAAAAVFEAVCGAVLAAVPSTTATATAMAGRPVPDTRIVGGGNADVRDVPW
QVSLRNRGGHICGGSIVRSDAVVTAAHCTVGAPPGSLSVRAGSAARGSGGQVVRVARVLR
HPKYDAATIDYDVAVLVLASPLRFGDGVRAVPLVPAGSEPSAGTPATVTGWGATRDGGAL
PERLRRVDVPKLSDAYCKGAYGPSSITPRMTCYGYQEGRKDACQGDSGGPLVVDGRLAGI
ASWGSGCAAPGHPGVYTKVSDPAIHDYITQS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggcatggctgcggggcggggcggcggcggccgcggtgttcgaggcggtgtgc
ggggcggtgctggccgccgttccgtcgacgacggcgacggcgacggcgatggcgggccgg
ccggtgccggacacccgcatcgtcggcggggggaacgcggacgtgcgggacgtgccgtgg
caggtgtcgctgcgcaaccgcgggggccacatctgcggcggttcgatcgtccgctccgat
gcggtggtgaccgcggcccactgcaccgtgggggcgccaccggggtcactgagcgtccgg
gcgggcagcgccgcccgtggttcgggcgggcaggtggtccgggtggcccgggtgttgcgg
cacccgaagtacgacgccgccacgatcgactacgacgtggcggtgctggtcctggcgtcc
ccgctccggttcggtgacggggtgcgggcggtcccgttggtgccggcgggcagcgagccc
tcggcgggcaccccggcgacggtcaccggttggggcgcgacccgggacggcggcgcgttg
ccggagcggctgcggcgggtcgacgtgcccaagctcagcgacgcctactgcaagggcgcc
tacggaccgtcctcgatcaccccgcggatgacgtgctacggctaccaggagggccgcaag
gacgcctgccagggcgacagcggagggccgctggtggtggacggccgcctggcgggcatc
gcgtcgtggggctcagggtgcgccgcgccggggcacccgggggtctacaccaaggtcagc
gatccggcgatccacgactacatcacgcagtcgtag

DBGET integrated database retrieval system