KEGG   Snodgrassella alvi: SALWKB2_0009Help
Entry
SALWKB2_0009      CDS       T03063                                 

Definition
(GenBank) YadA-like protein
  KO
K21449  trimeric autotransporter adhesin
Organism
salv  Snodgrassella alvi
Brite
KEGG Orthology (KO) [BR:salv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:salv02000]
    SALWKB2_0009
Transporters [BR:salv02000]
 Other transporters
  Pores ion channels [TC:1]
   SALWKB2_0009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YadA_stalk YadA_head ESPR Apolipoprotein Baculo_PEP_C
Motif
Other DBs
NCBI-ProteinID: AHN27391
UniProt: X2HCR4
LinkDB All DBs
Position
8698..19476
Genome map
AA seq 3592 aa AA seqDB search
MNKIYRAIWNESTQTWVAASELAKSKTKANTVSCGNNESPVLGKICSNAFKAGLLTSLVN
FALLAPNSYAGSGTHSLMGGATINSAYDGYQNVNTTAIEGDDFDYCGADNVSGRGSTQGN
SAAASKSISALEEYLRFAKNTAFSDNKTSYNPYGTTERVESWTQASGTGQVTQGKDQDGK
LTPGSGYQNRLTGGYTITYIKAFGIGSFAYGCNAYTTGNQSLAFNANATATAGGAQAFGV
AAYASGRASNAIGVSSQAAGVSGVALGSVANSAGVGSVAFGLQSNAVADGTVAVGVNAQA
SVDSAVAIGNDSFADGKESISIGSGNKVSGEGSIAIGNSETASTYAAVDGTQSGKSGGNT
IITGNRTLSIGNKNTGTTDTGGISAANTSLFGNKNKIYEALDGVHVIGNSNQIGVANATK
PLPGNGATVIGNNTIVTADNAIALGNSTYVSGESAIAIGNSAKATEAGAVALGKDSFANT
AGNVAGYNPNENASADSAWQSKVTGANTWKSTTGAVAVGNTSNTSDDKNITRQITGVAAG
SDYTDAVNVAQLKSLHSYALSSLNTESETFNNNLVSVGNSIDTLSTSVDSKLTDLNSKIN
SLSVTALGENGQLNRLDKNIADLSLSTSDGIKLLQQNTLQYKKDDNLGGFYNVGSDDGRT
QNKIINVEADDSVVTDGSTYLINGGLLNKTNSQISLLSSSISDGVTKLNSGADEVSSTTS
DKAPKIDAQMTDFNQSLSKDISNLRSVILEWTEEPDKSKTFKSKDETKITGVARGDAESA
SSSDAVTGGQLSEVNSLVTKVTNDVKTSTTNNDIQIDKLALDTDLQISDTNTKLDTLTTS
ISTGLSRITRNALLFNATAGKYQEDTNKTPQKISNAEAGDISENSDDAITGGQLYTTNTK
LINLSSSISAGWNTLSEQRSSISTSASSSLSTLSGIINGKLESLSTVTTNSLQTLSNNLQ
VLSSSASTAISNLQESTILYGADEMFHATRDNLAQKITGVAPADLSQNSMDMVNGGQLYT
TNSRIDSLSTAVNTNFSSLSGSISVSVSASLSDLSASLNVNRDKVSSLQANALQWDDIAK
AYSAKHGNTDSTTDGRQKITNVLEGNITSPDSTDAVTGGQYYNLDTAITDKVSTLSTNAL
SSVDGINKSISLLQQQMLTLDGNKFNAERAEIKQKITGVAEAALNSASTDAVVGKQLSST
NFSLSSLITSTNAGFKAFSNSLDQYSENTEKTRTDLVNGINTSISSLQSNALLWDKDNGY
SATHDIKGNQKITNVSALDGNLAPGSTDALTGSQVSRFITSRDKSINKVYADLQGLSADS
IKKLESEITNGLNGVNQEIAGLKQNLLLWNDKAGAYDASHNTSAGAEKITNVAEGRLVSG
STDAVTGKQLFTTKSNIATLSTSSVNDLDKKSNSINDNLNNQKTILGNSIATGINKLGSD
INSNIQSVDSGIEDLKQTALQWNGSSYDASHGQVGGKNKITNVDQGNLYDKSTDAVIGDQ
LARTNTSIKTLSDGLSTSLQKLSGSISSIVDQYSSDWEKDLITRKDSFSTSINSGLNNIN
TSLSKIKQNALLWNGSAYDASVENSKGAITNVAKGDLQKNSHDAVVGAQLFTTNTKLNSL
STSFDDKVKDYQSATQNSLNSLSTALGNSSFSGLESLSSSAALALGNINDGISDLKQNAL
QWKGNAYNAGYGAESEKKNITNVADGLLAKGSKDAVTGNQLYNTNVAISDLKKEVDDGVT
RLTSSHDIFDKNIAALTEKLEKTAGSLSSLSTTTETDLNSINTGISNLQDNALQWKDSAY
NAHHGTKDDKNIITHVAAGSLKEDSSDAVTGAQLFGTQSNITVLESKLTGVSDSLSSGIS
SLSDSLNNLTTSNLSALEQSRDHIESDITSLSSITSSVLSSADSDLAVLSENALQWKDGS
YDASHGKENDKNFIKNAGKGDVYAGSTDAITGDQLYTTGSHLDALSYSFSTSFDSFSTTL
NSLIDKGVGSLSSSVASIDGEVSKLQQNALQWNKSISAYDASSVTGKPAKITQVADGRVE
LNSSDAITGAQLFSLSTVSKDNLVNVASSMNLSLSTIQDSVDSSSASLSSQYNTLSKDIS
NNFNEFSTSTSLSLDSLSTGNSTTVSNLADGINTSLSAQSDSIDNSINKLSTEFDNNLNN
LTSNIAESAEELTNSLNTVNKGVNTLKQNALQWNEEAGAYSANHGTGNAQRITNVAAGNV
APDSSDAINGSQFFQLSGSASTGLNNLSTSLSTVTNNQLNSLSTIISNSLSTVNQNVSSL
STGLNTVTEKVTALQTDALQWDKVNGNYKADHGTGNAQKITQVAAGSIAANSTDAVNGAQ
MYSLSTGTADSVNKLTENLNKTNLGLGSLSTATNTDLKNLKDSLKSTNDGLTQLSSSTSG
SIQSISTSLDTLTTSTANSLQALDKGLKDTSSSVSALQTNALQWNADKGVYDASRNGSAK
VLSGVAAGAVSAVSTEAVNGGQLYSLSTVTVAGLNSVSTGLSSLSESATTGLNNLSASLS
SANQNLTTLQQNALQWNSTLTAYDAGHNGTAQRITNVAAGNIALDSTDAVNGGQLFSLSS
SASTGLSSLSTNLSKVTDNQLGSLSTIIGDNLNTVNQNVSSLSSSLNDTNTNVGNLQKDA
LQWNSTISAYDATRGGRAQTLTGIAGGDISPTSSDAVNGAQMYSLSTLTQTGLSSSSTGL
SSLSSVTSSALNNVNRSLESLSTETHTGLNSVSTGLSSLSESTTTGLNNLTASLNSTNQN
LTTLQQNALQWNGTAYDAGRSNTVQKITNVAAGRIAVDSTDAVNGSQFFNLSGSTSTGLN
SLSTSLSTVTNDQLSSLSTITGDNLNTVNKNVTSLSTSLDKTNINVGNLQKDALQRNRVS
GDFDARREDKEQKLTGIAAGDISATSSDVINGTQMFRLSTLTQTGLGSISTGLSSLSSVT
SSSLDNVNRSLESLSTETHTGLNSVSTGLSSLSESTTTGLNNLTASLNSTNQNLTTLQQN
ALQWNSTLTAYDAGHNGIAQRITNVAAGRIAADSTDAVNGGQLFSLSGSTSTGLSSLSTV
VSSTVINGISTISSSLSTGYESLSHSLSTATDNLQQLTNITSSSLSSLSTVASTTQNDVT
DLKEKVLKWNDDKGGFDAGRPNNLTRDPGLGKIYNVKDGEIAAGSHEAVTGGQLYTVQTD
LSALSTSTSDIVNSLNKTLDELSTSNVITNVANLTKNALQWKDDGTGHNTGFYDAGYNGT
AQRITNIAAGNIAQGSLDAVNAGQLWTVQSSLSTLSTKVDALPTGNVSDAELASLSTAIS
TGIANQISTAASSLGTSYQPSANSIEPPKYDSITPTGGVVSADNVDDALANLRNYGTKFV
KSNSAKATSVAQGADSIAVGGAAMASGTSAVAIGDSASAPSANAVALGSQAKVTQTGGVA
LGAGSVANTAAGIESYIPVTATSQQAAAIRATKSTEGAVSVGDASKDIYRQITGVAAGTA
DTDAVNVAQLKGVDNQVSRINEYVNQINDNVHRVERRAYSGTAMAMALSGAYLPSLNGGE
QTVGVGVGAYRGYGAIGVNYKAASKNGKITWGAGVSTTGKEVAVNSVLGFKW
NT seq 10779 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaaatatatcgtgcgatatggaatgaatccacgcagacatgggtggctgcttct
gaattagctaaaagtaaaactaaggcaaatactgtttcctgtggaaataatgaatcgcct
gtattgggtaaaatttgtagtaatgcgttcaaagctggtttactgacatctctagttaat
tttgctttactggcacctaatagctatgcaggctcagggactcactctttaatgggggga
gctaccattaactctgcctatgatggttatcaaaatgtcaacactacagctattgagggt
gatgactttgactattgcggtgctgataatgtaagcggccggggtagtactcagggtaat
tcagcggctgcatcaaaatctatttctgctttagaagagtatttacgctttgcaaagaat
acagcgttttcagataataaaacttcttacaacccttatggtacaaccgaacgggttgaa
agctggacacaagctagtggtacagggcaagtaacacagggtaaagatcaggatggtaag
cttacacctggttctggataccagaaccgacttactggtggctacacgatcacatatata
aaggcttttggtataggttcttttgcttatggctgtaatgcttatactacaggaaatcaa
tccttagcatttaatgctaatgctactgctacggccggtggagctcaggcatttggcgta
gcagcatatgcttcgggtcgggcatctaacgctataggtgtttcttctcaggctgcagga
gtatccggtgtcgcattaggttctgtagctaactctgcaggagttggaagtgttgctttc
ggtttacagtcaaatgctgtagccgatggtactgttgctgtaggggttaatgctcaggct
tctgtggattctgcagttgctattggtaatgacagctttgcagacgggaaagaaagtatc
agtattggttcaggtaataaagtttcaggtgaagggtcaattgctataggcaattctgaa
accgcctctacttatgccgctgtagacggtactcagagtggtaagtccggcggtaatacc
ataatcaccggtaaccgcacactttctataggtaataaaaataccggtacaacagatact
ggtggtatttctgccgccaatacatcattatttggtaacaaaaataaaatttatgaagcc
cttgatggtgttcatgtaattggtaatagtaatcagattggtgttgccaatgcaactaaa
ccgcttcccggtaacggcgctacggtaattggtaataatactattgttactgctgataat
gctattgctctgggtaacagtacctatgtcagtggtgaaagtgcgattgctattggtaac
agtgccaaagctacagaagccggagctgttgctctgggtaaagattcttttgcaaatact
gcaggaaatgttgccggttacaatccgaatgaaaatgcatctgctgatagcgcatggcaa
agcaaggttactggtgcaaatacatggaaaagcactaccggtgcagtagcagtaggaaat
acctctaatacctctgatgataagaacattacccggcagataacaggtgtagccgccggt
tctgactatactgatgcagtcaatgttgctcagttgaagagtttacattcttatgcctta
agcagtttgaataccgaatcagaaacttttaataataatctggtttctgttggcaattca
atcgataccctttcaacttcagtagatagtaaactaacggatctgaattcaaagatcaat
tctctctcggtgacggcattaggagagaatggacaactcaacagactggataaaaatatt
gctgatttaagtctgtcaacttctgacggtatcaagttattacagcagaatactttacag
tataagaaagatgataatctcggaggtttttataatgttggttctgatgatgggagaact
caaaataaaataatcaatgtggaagcagatgattctgtagttactgacggatctacatat
ttgattaatggtggtcttttaaacaaaactaattctcagatcagtctgttatcatcaagt
ataagcgatggtgttactaaacttaactccggagctgatgaagtttcatcgactacaagt
gataaagcaccgaaaatagatgctcagatgactgattttaatcagtctctttctaaagat
atcagcaatttaagatcggttatacttgagtggactgaagaacctgataaaagtaaaact
tttaaatctaaagatgaaacaaaaataaccggtgttgccagaggtgatgcagaaagtgca
agttcctcagatgctgtaaccggcggacaattaagtgaagttaactcattagttactaaa
gtaactaatgatgtgaagactagtactaccaataatgatattcagattgataaactggca
ttagatacagatttgcaaatatcggacactaatactaagctggatactctgactacttct
atttcaacaggtttgagccgcataacacgtaatgctcttttgtttaatgcaaccgcaggt
aaatatcaggaagatactaacaagactccgcaaaaaatcagtaatgcagaagcaggtgat
ataagtgaaaattctgacgatgcaataaccggaggacaactatatactacaaatactaaa
ctgataaatctgtcttcatctatttctgccggatggaatactctttctgaacagcgcagc
agtatttcgacttcagccagcagtagtcttagtactttatccggtataataaatggaaaa
ctggaatcattatcaacagtcactactaatagtttacaaactttaagtaataatctgcag
gtattatcttcttctgcctctactgcaatcagtaatttgcaggaaagtacaatattatac
ggcgcagatgagatgttccatgccacgcgtgataatctggctcaaaaaataaccggtgtt
gctccggcagacctgagtcagaattcaatggatatggttaatggtggtcagttatatacc
accaattccaggattgacagtctgtccactgctgttaacactaatttcagcagcttatcc
ggttcaatatctgtgtcagttagtgcgagcctgagtgacttatcagcaagtctgaatgta
aacagagataaagtttcttctctgcaggctaatgcactgcaatgggacgatattgctaaa
gcttacagtgcaaagcatggtaatacagatagtactacagatggcaggcagaaaattact
aatgttcttgaaggcaatattaccagtccggattcaaccgatgcggtaaccggcggacag
tattataatctggatactgctataactgacaaagtaagtacactttcgacaaatgcgctg
agttctgttgatgggattaataagagtatctcattattacagcaacagatgttgacgctt
gacggaaacaaatttaatgctgaacgtgctgaaataaaacagaaaattaccggtgtggct
gaagctgcgctgaatagtgcctcaacagatgctgttgttggaaagcagctgtcttcaacg
aatttttctctgagtagcttaattacttcaactaatgccggatttaaagcattttccaac
tcgttagatcagtactctgaaaataccgaaaaaacaaggacggacttggtaaatggtatt
aatacaagtatcagttctttgcagagtaatgctttactgtgggacaaagataatggatac
agtgctacccatgatattaaaggaaatcagaaaattaccaacgtttctgctcttgatggt
aatcttgccccgggttcaactgatgcattaacaggtagtcaggtcagccgtttcattact
tccagagataaaagtattaataaagtatatgcagacttacaaggcttatctgcagattca
atcaaaaaactggaaagtgaaattacgaatggtctgaatggagttaatcaggaaatagcg
ggattaaaacagaatctgttactatggaatgacaaagccggagcttatgatgccagtcat
aatacgtctgctggagcggaaaaaattaccaatgttgctgagggcagattggtttccggt
tcaacggatgctgtaaccggtaaacagttatttacaactaaatctaatatcgcaacgctg
agtacatcatcagttaatgatctggataagaaatccaatagcattaacgataatctgaat
aatcaaaagactattctgggcaattctattgctacaggtatcaataaactgggcagtgat
ataaattctaatatacagtcagtagattctggtattgaagacttgaaacagactgcgctg
caatggaacggtagttcttatgatgccagtcatggtcaggtaggcggtaaaaacaaaatc
accaatgtggatcagggtaacttatatgataaatcaaccgatgcagtaataggtgatcag
ttagccagaaccaataccagtattaaaactttatctgacggtcttagtaccagtctgcag
aaattatccggttccatttcttctatcgtggatcaatattcatctgactgggaaaaagac
ctgattacccggaaagattctttctctacaagtattaattccggtttaaataatattaat
accagtctttcaaagataaagcaaaatgcattactatggaacggtagtgcttatgatgcc
tctgttgaaaatagtaaaggagccattactaatgtagcaaaaggtgatttgcagaaaaat
tcacatgatgcagtagttggtgctcagttgtttactactaatacgaagctaaattcgctt
tctacatcatttgacgataaagtaaaagattatcaaagtgcaactcaaaacagtttaaac
agcttatctacagctctgggcaattcttctttttccggtcttgaaagtctgtcttcatca
gctgcactagctctgggtaatataaatgatggtatttcagatctgaaacagaatgcattg
cagtggaaaggcaatgcctataatgccggctatggtgctgaaagtgaaaagaaaaatatt
accaatgttgccgatggtctgcttgcaaaaggatcaaaagatgcagtcacaggtaatcag
ctctataatactaatgtagctatcagtgatctgaaaaaagaagtagatgacggtgtaacc
cgtttaaccagttcccatgatatttttgataaaaatatagctgctttaactgaaaaactt
gaaaaaactgctggcagtctgtcaagtttgtctacaactactgaaaccgatctgaacagt
attaatactggtatttccaatttgcaggataatgctttgcaatggaaagatagtgcttat
aatgcccatcatggtacaaaagatgataaaaacatcattactcatgtggcagcaggtagt
ctgaaagaagattcatcagacgcggtaacgggtgcacagctattcggtacccaaagtaat
attaccgttctggaaagcaaactgacaggtgtatctgatagtttgagttctggtatcagt
agtttatctgactcactgaataatttaaccacttccaatttgtctgctctggagcagagc
agagaccacattgaaagtgatattacaagtctctcttcaattacctcttcagtactaagc
tcggctgacagtgatctcgctgttctcagtgaaaatgcattacagtggaaagatggttca
tatgatgccagccatggcaaagaaaatgataaaaattttatcaagaatgctggtaaaggt
gatgtatatgccggttcaaccgatgccattaccggcgatcagttatatacaaccggcagc
catttggatgcactgagttatagtttcagtactagttttgatagtttttcaactacatta
aacagtttaattgataaaggtgttggaagcctttctagcagtgttgccagtattgatgga
gaagtaagtaaattacaacagaatgcgttacaatggaacaagagtatttctgcatatgat
gcaagttctgtaactggcaaaccggcaaaaattactcaggttgccgatggtcgggtagaa
ttaaattcgtcagatgctattactggtgctcaactgtttagcctgtccacggtgtctaaa
gataacctggtcaacgtagcctcctcaatgaatttaagtttaagtacaatacaagattca
gtagatagttcctctgcttcactttctagtcaatataatacgttatcaaaagatatttcg
aacaatttcaatgaattttccactagtacttcgctaagtttagacagcttgtccactggt
aattcaactactgtgtcgaatctggctgacggtataaatacaagcctgagcgctcagtct
gacagtatagacaatagtatcaataagctgtctacagaatttgataataatctgaataac
ctgacttcaaatattgcagaatctgctgaagaattaactaattcattaaatactgttaac
aagggtgtaaatacactcaagcagaatgcactgcaatggaatgaagaagccggtgcgtat
agtgcaaatcatggaactggtaatgcacaaagaattaccaacgtagctgccggtaatgta
gcgccggattcaagcgatgctattaatggcagccagttcttccaactgtccggctcagca
tcaacagggctgaacaatctgtcaaccagtctgagcacagtaaccaacaatcagttaaac
agtctgtctactattattagtaatagtctgagcactgtgaatcaaaacgtatccagtttg
tcaaccggactgaatactgttactgaaaaggttactgcattgcagactgatgcactgcaa
tgggataaagtaaacggtaattacaaggctgatcatggtaccggtaatgctcagaagatt
acacaggtagcagcaggttcgatagcggcaaattctaccgatgcagttaacggtgcacag
atgtacagtttgtcaaccggtactgctgacagtgtcaataaactgactgaaaatctgaat
aaaaccaatttaggtttaggttcactgtccacagcaacaaacacagacctgaaaaatctg
aaagacagtttgaagagcaccaacgatggactgactcagctgtcatccagtacttcaggc
agtatacagagcattagcaccagtctggacacactgactacttctacagctaacagcctg
caggctctggacaaaggtctgaaagataccagcagcagcgtatccgcattgcagactaat
gccttgcagtggaacgcagacaaaggtgtttatgatgccagccgaaacggcagtgccaaa
gttctgagtggtgtggcagcaggagcagtgagtgcagtatccacagaagcggttaacggc
ggacagctgtatagtctgtctacggtaactgtagcaggactgaacagtgtcagcaccggt
ctgagcagtttgtcagagtctgcgactaccggtctgaacaatctgtcagccagtctgagc
agtgcgaatcagaatctgactaccttgcagcagaatgcattgcagtggaacagcacactg
actgcttatgatgccggtcataatggtacggcgcagcggattaccaatgtagcagcaggc
aatatagcattggattctacagatgcagtaaacggtggtcagctattcagtctgtccagc
tcagcatcaacaggactgagcagtctgtcaaccaatctgagtaaagtaaccgacaatcag
ttaggcagtctgtctactattattggtgataatctgaacactgtgaatcaaaacgtgtcc
agtctgtcatccagtctgaatgatactaatactaatgtaggcaatctgcagaaagatgca
ttgcaatggaacagtacaattagtgcctatgatgcaacccgtggcggtcgtgcgcagaca
ctgaccggaatagccggcggggacatcagccctacatcaagtgatgcggttaacggtgcg
cagatgtacagtctgtcaacgctgactcagacaggtctgagcagcagcagtactggtctg
agcagcctgagcagtgttacctcatctgctctgaataatgtaaatagaagtctggagtca
ctgtccacagaaactcatacaggactgaacagtgtcagcaccggtctgagcagtttgtca
gagtctacgactaccggtctgaacaatctgacagccagtctgaacagtacgaatcagaat
ctgactaccttgcagcagaatgcattgcagtggaatggcactgcgtatgatgccggtaga
agtaatactgtacagaaaattactaacgttgcggcaggcagaatagcagttgattctact
gatgcagtgaacggcagccagttctttaacctgtcaggttcaacatcaacagggctgaac
agtctgtcaaccagtctgagcacagtaaccaacgatcagttaagcagtttgtctactatt
actggtgataatctgaacactgtgaataaaaatgtgactagtctgtcaaccagtctggat
aaaactaatattaatgtaggcaatctgcagaaagatgcattgcaaagaaaccgggtaagc
ggtgattttgatgcaagacgcgaagataaagagcagaaactgactggtatagctgccgga
gatatcagtgcaacttcatctgatgttattaacggtacgcagatgttcagactgtcaacg
ctgactcagacaggtctgggcagcatcagtactggtctgagcagcctgagcagtgttacc
tcatcttctctggataatgtaaatagaagtctggagtcactgtccacagaaactcataca
ggactgaacagtgtcagcaccggtctgagcagtttgtcagagtctacgactaccggtctg
aacaatctgacagccagtctgaacagtacgaatcagaatctgactaccttgcagcagaat
gcattgcagtggaacagcacactgactgcttatgatgccggccataatggtatagcgcag
cggattaccaatgtagcagcaggcagaatagcagctgattctacagatgcagtaaatggt
ggtcagctattcagtctgtccggctcaacatcaacagggctgagcagtctgtcgacagta
gtttcatccactgttattaatggaatcagcactataagcagctccctgtctaccggctat
gaaagtctgtcacacagcctgagtacggcaacagacaatctgcaacagctgacaaacatc
accagcagcagtctgagcagcttatcaactgttgcaagtacaactcagaacgatgtgaca
gatctgaaagagaaagtactgaaatggaatgatgataaaggcggatttgatgcaggaaga
ccaaacaatctgacccgtgatccaggtttaggtaagatctataacgtgaaagatggtgag
attgcagcgggttcgcatgaagcagtaaccggcggacagctttacacagtgcaaaccgat
ctgtctgctctgtcaacatctacatcggatatagtgaattcattaaacaaaactctggat
gaattatcaacaagtaatgttattactaacgtagctaatctgaccaaaaatgcattgcaa
tggaaagatgatggtacaggtcacaatacagggttttatgatgctggttataatggtact
gcacagcggattaccaatattgcagccggtaatatagctcaaggttctcttgatgcggtt
aatgccggtcagttgtggacggtacaaagcagcctgagtactctgtcaactaaagtagat
gctctgccgacggggaatgtttcagatgctgaactggccagtctgtcaacggcaatcagt
acaggtatagccaatcagatttctaccgcagcgtctagtctgggtacttcctaccagccg
agtgcaaacagtattgagccgccaaaatacgatagtattacaccgacaggaggtgtggta
tcggcagataatgtagatgatgcactggcaaatttgaggaattacggtactaagtttgtg
aaaagtaattctgcaaaagcaacctcagttgcacagggtgctgattctatcgcagtaggc
ggagcagctatggccagcggaacatcggcagttgcaatcggtgattctgcaagtgctccg
tcagccaatgctgtggcactgggtagtcaggctaaggtaacacagaccggaggcgtagca
cttggtgcgggttcagtagcgaatacggcagccggaatagaaagctatattccggtaacg
gcaacgtcacagcaggcagcagcgatccgggcaacgaagagtacggaaggtgcggtatct
gtaggtgatgcatcgaaagatatatatcgtcagataaccggagttgcagcaggtacggct
gatactgatgcagtaaacgtggctcagcttaaaggtgttgataatcaggttagcagaata
aatgaatatgttaaccagataaatgataatgttcaccgtgttgagcgccgtgcatattca
ggaacggcaatggccatggccttgtccggtgcttatctgccttccctgaatggtggtgaa
cagaccgttggtgttggtgtcggtgcatatcgtggctatggtgctattggtgtaaactat
aaggcagcaagtaaaaacggcaaaataacatggggtgcaggtgtttccacaacaggtaaa
gaggtcgcagttaattctgtacttggctttaagtggtaa

DBGET integrated database retrieval system