KEGG   Snodgrassella alvi: SALWKB2_0050Help
Entry
SALWKB2_0050      CDS       T03063                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
salv  Snodgrassella alvi
Pathway
salv00061  Fatty acid biosynthesis
salv00780  Biotin metabolism
salv01100  Metabolic pathways
salv01212  Fatty acid metabolism
Module
salv_M00083  Fatty acid biosynthesis, elongation
salv_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:salv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SALWKB2_0050
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SALWKB2_0050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:salv01004]
    SALWKB2_0050
Enzymes [BR:salv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SALWKB2_0050
Lipid biosynthesis proteins [BR:salv01004]
 Fatty acid synthase
  Component type
   SALWKB2_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AHN27432
UniProt: X2H8L8
LinkDB All DBs
Position
60866..61324
Genome map
AA seq 152 aa AA seqDB search
MDWSLPLDIRTLQKLLPHRYPFLLIDRVIAYDSEAMTLSAIKNVTANEPFFLGHFPDFPV
MPGVLIIEAMAQACGTLAILSHGGRDDDEIYFFVGIDNARFKRQVVPGDQLKFEVKLLAN
KRDIGKFKAVALVDNQVAAEAEIMCAKRKVEK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggattggtctttacctttagatattcgtaccctgcagaaattattacctcatcgttat
ccgtttttactgattgatcgtgttatcgcttacgacagtgaagccatgactttgagtgca
attaaaaatgtcacagctaatgaacccttttttcttggtcattttcctgattttccggtt
atgcctggtgtgttgattattgaagctatggcacaggcatgtggaacactggctatttta
agtcatggcggtcgtgacgatgatgaaatttatttttttgtaggcatcgataatgcccgt
ttcaagcgtcaggttgtccccggcgatcagctgaaattcgaagttaaattattggcaaac
aaacgtgatatcggtaaattcaaggctgttgctttagtagataatcaggttgcagcagaa
gctgaaatcatgtgtgccaaacgcaaggtagaaaaataa

DBGET integrated database retrieval system