KEGG   Snodgrassella alvi: SALWKB2_0104
Entry
SALWKB2_0104      CDS       T03063                                 

Definition
(GenBank) tssB
  KO
K11901  type VI secretion system protein ImpB
Organism
salv  Snodgrassella alvi
Brite
KEGG Orthology (KO) [BR:salv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:salv02044]
    SALWKB2_0104
Secretion system [BR:salv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SALWKB2_0104
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AHN27486
UniProt: X2HD34
LinkDB
Position
135977..136528
AA seq 183 aa
MAVVNSSAQKFIQRNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLSGKPAEELPPVAE
RKFLTIDIDNFDERMKAIQPRVAFAVPNTLSGDGHLMVDITFESMEDFSPARVAQKVDAL
KQLLDARTQLANLQTYMDGKSGAENLVNRLLQDPGLLQALAKAPKPQSATEEKTGASAPG
DSK
NT seq 552 nt   +upstreamnt  +downstreamnt
atggcggtagttaacagcagcgcccagaaatttattcagcgcaatcgtgcgccaagggtg
caaattgagtatgacgttgaaatttacggttccgagaaaaaaatcgagctgccatttgtc
atggctgtgctggcagacttgtccggtaaaccggcagaagaattgccaccggttgcagag
cgcaaatttctgaccattgatatcgataatttcgatgaacggatgaaagccattcagcca
cgtgtggcatttgccgtaccaaataccttatcaggtgacggacaccttatggttgatatc
acttttgagagtatggaagatttctcaccggcacgcgtggcacaaaaagttgatgctctg
aaacaattgctggatgcacgtacccagctggctaacctgcaaacctatatggatggcaaa
tccggtgctgagaatttagttaaccggctgttacaggatcctggtttgttgcaggcactg
gccaaagcaccaaaaccacagtcagcaactgaagaaaaaaccggggcatctgcacctggg
gatagcaagtaa

DBGET integrated database retrieval system