KEGG   Snodgrassella alvi: SALWKB2_0105
Entry
SALWKB2_0105      CDS       T03063                                 

Definition
(GenBank) tssC
  KO
K11900  type VI secretion system protein ImpC
Organism
salv  Snodgrassella alvi
Brite
KEGG Orthology (KO) [BR:salv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:salv02044]
    SALWKB2_0105
Secretion system [BR:salv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SALWKB2_0105
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AHN27487
UniProt: X2H8S8
LinkDB
Position
136572..138080
AA seq 502 aa
MATQSKQQSDVAVAERPVAQSEFSNLLTKEFKPKTDQAAKAVEQAVKTLAEQALSHSVTI
SDDAYKSIEAIIAEIDHKLSEQINLILHHESFQKLESSWRGLFHLVSNTEVDEHLKIRFM
NLSKDDLRRSMKRFKGIAWDQSPLFKQIYEEEYGQLGGEPYGCMIADYYFDHTPPDVDLL
GSVAKVAAASHMPFIAGASPAVLQMDSWQELANPRDLTKIVTQNLEYAPWNSLRASEDSR
YLGLAMPRFLARLPYGIKTNPVDEFDFEEDTDGSDHRKYVWSNAAYAMGVNINRSFKHFG
WCTMIRGVESGGTVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELSKNGFIPLIHRKN
TDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKER
EDMQRWLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQ
LEGLTGSLRLVTKLPSVKKENA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggctacacagtcaaaacagcaatccgatgtcgcagtggcagaacgcccggttgcgcaa
tccgaattcagcaatttactaaccaaagaatttaaacctaaaactgatcaggctgccaag
gctgttgaacaggcagttaaaactttagcagaacaggcactgtctcattcagtaaccatc
agtgatgatgcttataaaagtattgaagctattattgctgaaattgatcataagctttcc
gagcagatcaatctgattctgcatcatgaatctttccagaaactggagtcatcatggcgc
ggtctgtttcatctggtatccaatactgaggtggatgaacatttgaaaattcgtttcatg
aatctgtctaaagatgatttgcgccgcagcatgaaacgttttaaaggcattgcatgggat
cagagtcctttattcaaacagatttatgaagaagaatatggtcagcttggtggtgaacct
tatggctgtatgattgctgattattattttgatcacacaccaccggatgtggatctgctt
ggttcagttgccaaagtagcagctgcttcacatatgccgtttattgccggtgcgtcacca
gctgtactgcaaatggattcctggcaggaattggctaatccgcgcgatttaaccaaaatt
gttacccagaatctggaatacgctccgtggaactcgctgcgtgccagtgaagattcacgt
tatcttggtttggctatgcctcgtttccttgcgcgtttaccatatggcattaaaaccaat
ccggtagatgaatttgattttgaagaagatacagacggatcagatcatcgcaaatatgta
tggagtaatgccgcttacgccatgggtgttaacattaaccgttcatttaaacactttggc
tggtgtaccatgattcgcggcgttgagtcaggtggtaccgttgaaaatctgccatgtcat
actttcccgactgatgacggtggtgtggatatgaagtgcccgaccgaaatcgccatttct
gaccgtcgtgaagcagagttatcaaagaatggttttattccgctgattcatcgtaagaat
acagactacgcagcatttataggtgcgcaatctctgcaaaaacctcaggaatattatgat
ccggacgctacagccaatgctaatttgtctgcacgtttaccttatctgtttgcgtgctca
cgttttgcgcattttctgaaatgtatcgtacgcgacaaaattggttcattcaaagagcgt
gaagatatgcagcgctggctgaatgaatggattatgaattatgtcgacgcagatccggtg
aattcatcacaggaaactaaagcgcgccgtccgctggctgctgcagaagtagtagtagaa
gaagttgaaggcaatccgggatactacgatgccaaattcttcctgcgtccgcatttccag
cttgaaggactgaccggctctctgcgtctggttaccaagctgccgtctgtgaaaaaagaa
aatgcataa

DBGET integrated database retrieval system