KEGG   Snodgrassella alvi: SALWKB2_1107Help
Entry
SALWKB2_1107      CDS       T03063                                 

Definition
(GenBank) Penicillin-binding protein 2 (PBP-2)
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
salv  Snodgrassella alvi
Pathway
salv00550  Peptidoglycan biosynthesis
salv01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:salv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SALWKB2_1107
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SALWKB2_1107
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:salv01011]
    SALWKB2_1107
Enzymes [BR:salv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SALWKB2_1107
Peptidoglycan biosynthesis and degradation proteins [BR:salv01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   SALWKB2_1107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AHN28489
UniProt: X2H500
LinkDB All DBs
Position
1218450..1220489
Genome map
AA seq 679 aa AA seqDB search
MKALQFRTKKKRVSKPAQNGDLGLRIAVAFALIIICFSMLIARFVYLQVIKYDEYVIAAT
NNRISLIPTPPIRGEIVDVNGVVLAHNYPAYSLEITPNQIPGKLEDTINALRNYVDITPS
DMKRFNKFRAEYRSYEKVPLKLKLTMEEASRLAAELYRFPGVEINARTFRDYPYGELLAH
IVGYIGRISDRDMAALDKAELTTLYRGSTHIGKMGLEEYYERQLHGIPGYREVEKDAQGH
IVRTIKTVPAVPGQTLRLGLDIRVQQEADRLMGDKRGALVAINPQTGAILAMVSKPSYNP
NLFIDGIDTDTWKSLNEDWRHPLLNRATQGMYPPGSTFKPFLAMAALESGKLTQSTVLPA
PGFWSIPGSTHQFRDAARGGHGSANLNKAIQVSSDTFFYRLGYEMGVDRMSPYLAEFNLG
KQTGIDINHEYAGVLPTRAWKEKRFARSKPQARVWQPADSVSMAIGQGYNAYTPLQMAFA
TAILSNDGVVYRPHLVQALLDHNSKKMTLIDPQPVRTVPFKRGNFEYVKDAMQKVLKPGG
TAAAVGSGLAYTMGGKTGTAQVVQIKQGARYNAAALKLQLRDHAWFIAFAPADKPQIAIA
VILENNGWGATAAPLARQLADFYLLKLKNLPSAKEAANSADLPVNDLSNNAMMDAKQHNE
HSQTDLPPLLRAYRPQPGL
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactgcaattccgaactaaaaaaaagcgtgtatctaaacctgcgcaaaatggc
gatctcggtttacggattgcagtagcctttgctttgattattatttgtttttctatgctg
attgccaggtttgtatacttgcaagtaatcaaatatgatgaatatgtcattgccgctact
aataatcgtatctcattaattcctacaccacccattcgtggagaaatagttgatgttaat
ggcgtggtactggcacataattatccggcttattctcttgagataacccctaatcagata
ccgggtaaactcgaagatacaattaatgccttgcgcaactatgtggacattacccccagc
gatatgaagcggtttaataaattccgggcagaataccgttcttatgaaaaagtaccttta
aaacttaagttaacaatggaagaagccagccgtctggcggctgaactttatcgttttccg
ggtgttgaaattaatgcgcgaacatttcgcgattatccttatggcgaattacttgctcac
atcgtaggctatatcggccggatcagcgaccgcgatatggcagctctcgacaaagctgaa
ctgacaacactttatcgtggtagcactcatataggaaaaatggggctggaagaatactat
gaacgccaattacatggtattccgggttatcgtgaagttgaaaaggatgcgcagggacat
attgttcgtactattaaaacagtgccggcagtgcccggacaaacgcttcgtctgggactc
gatatccgtgtacagcaagaagcagaccggttgatgggtgataaacgtggtgctttagtt
gctattaatccgcaaacgggtgcgatactggctatggtatccaaacccagctataacccg
aatctgtttattgatggaatcgatactgatacgtggaaaagtctgaatgaagactggcgt
cacccgcttttaaatcgtgcgactcagggtatgtatcctcccggatctacatttaagcct
tttctggcaatggctgccttggaaagtggcaaactgactcagagtacagttttacctgct
ccggggttttggagtattcccggatcaacccatcagtttagggatgctgcgcgaggtggc
catggatcagccaatctgaataaagctattcaggtttcgtcagatacatttttttaccgt
ctgggctatgaaatgggggtggatcgtatgtcaccttatttagctgagtttaatcttggt
aagcagacgggtattgatataaatcatgaatatgctggtgtattgccaacacgcgcttgg
aaagaaaaaagatttgcccgctctaaacctcaggcacgcgtatggcagccggctgatagt
gtgagcatggccatcggtcagggctataatgcgtatactcctctgcagatggcttttgct
acagcaattctcagtaatgatggtgtggtttaccgccctcatctggttcaggcattactt
gaccataattcgaaaaaaatgactttaatcgacccgcaaccagttagaactgtccctttc
aaacgtggcaattttgaatatgttaaagatgctatgcaaaaagtattaaaaccgggtggt
acggctgcggcagtaggttctgggctggcttatactatgggcggcaaaaccggtactgct
caggtcgtacagattaaacaaggtgcacgttataatgcggcagcattaaaactacagctg
agagaccatgcatggtttattgcattcgcgcctgcagataagccacagatagcgattgca
gttattcttgaaaacaatggttggggtgctacagcagcccctctggctcgtcaattagct
gatttttatcttttgaaattaaaaaatctccctagtgcaaaagaagcagctaattctgca
gacttaccggtgaatgatttatccaataatgccatgatggatgcaaaacaacataatgag
catagtcagactgacttacctccgttattgcgtgcttatcgtcctcagccaggcctgtga

DBGET integrated database retrieval system