KEGG   Snodgrassella alvi: SALWKB2_1458Help
Entry
SALWKB2_1458      CDS       T03063                                 

Definition
(GenBank) Multimodular transpeptidase-transglycosylase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
salv  Snodgrassella alvi
Pathway
salv00550  Peptidoglycan biosynthesis
salv01100  Metabolic pathways
salv01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:salv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SALWKB2_1458
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SALWKB2_1458
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:salv01003]
    SALWKB2_1458
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:salv01011]
    SALWKB2_1458
Enzymes [BR:salv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SALWKB2_1458
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SALWKB2_1458
Glycosyltransferases [BR:salv01003]
 Polysaccharide
  Bacterial polysaccharide
   SALWKB2_1458
Peptidoglycan biosynthesis and degradation proteins [BR:salv01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   SALWKB2_1458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB DUF2680
Motif
Other DBs
NCBI-ProteinID: AHN28840
UniProt: X2H8X7
LinkDB All DBs
Position
complement(1623510..1625858)
Genome map
AA seq 782 aa AA seqDB search
MIRKLLLSTVGLLAGLALFAVGLLAVAIMVTYPKLPSLEAVTHYQPKLPLTIYSADNKLL
GQFGEEKRAFTRINDFPQVLKDAVVAAEDKRFYDHGGVDFIGVTRALITNLTGGVQSGAS
TITQQVARNFYLTNERTYTRKFNEALLAYKIEQKLSKDQILELYFNQIYLGQRAYGFAAA
SLVYFNKPVQKLDLAEATILAGLPKAPSTFNPVVNPQRAKMRQRYILNNMVEMGKITQAQ
ADAAFAEPLNYVHYQQPIDQNALYVAEMVRQQMYEKYGDAAYTQGFRVYTTVNSQDQAVA
TEALRKTLNNFDRGSAYRGAEGFFDLSKIPEDIRDEQIEQYLANRSAVDGMLPAVVTELG
SNSIVVYIGGVGESRISGSSYNWIKRTINNAKLDDAAVRVGSVVHVRGDGKSYRIVQQPE
LQGAIVALDAQTGAVKALVGGYDFYRRSFNRVTQAKRQPGSSFKPFIYSAAIAKGFTPAT
VVNDAPIVMPGMGAGGRAWTPKNSDGRYAGFITLRQALTASKNMVSIRILMAMGVDYARQ
YVQHFGFRLDQIPNSLSMALGSGEVTPMQMAEGYAIFANGGFKVSNYVIDRIYDSRGNLR
AQMQPLVAKQNAPQAIDPRNAFILYHMMMDVVNHGTAYSAHALGRSDIAGKTGTTNDNKD
AWFVGFNPNIVSAVYIGYDRPRSMGRSAFGGTIAVPVWLEYMRYALKGKPIVNTPVPAGI
IQKSGEYFLKEHQTTNPDLPLDNRADGPVTAKTNGKSGDVDDAGEVPVVPKSGTNSQLDS
LF
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgattagaaaattattactttcaaccgtaggtttgcttgccgggctggcgctttttgct
gtcggtttgctggcagtagcgattatggttacctatccgaagctgccttctctggaagca
gtgacgcattatcaacccaaactgccgcttacaatttattcggcagataataaactgctg
gggcagtttggagaggaaaaacgtgcttttacaagaatcaatgactttcctcaggtgctg
aaagatgcagtggtagccgctgaagataaacgtttttatgatcatggcggagtcgatttt
attggtgtaacccgtgctttgattacaaatctaactggtggtgtgcaatctggtgccagt
acgattactcagcaggtagcacgtaatttttatctgactaatgagcgcacctatacgcgt
aaatttaatgaagcgcttcttgcttacaagattgaacagaaattaagtaaagatcagatt
cttgagctttattttaatcagatttatctggggcagcgtgcttatgggtttgctgccgct
tctcttgtttattttaataagccggtacaaaaactggacttggcagaagcaacgattttg
gctggtttacctaaggctccttccacctttaatcctgttgtaaatccgcaacgggctaaa
atgcgccagcgttatattctcaataatatggtggaaatgggcaaaattacacaagctcag
gctgatgctgcttttgcagaaccattaaattacgttcattatcaacaacctatagatcag
aatgcgctctatgttgctgaaatggttcgccagcaaatgtatgaaaaatatggtgatgca
gcctatacacagggatttcgcgtttatacaacagtcaattcacaggatcaggctgtagca
actgaagcattgcgtaaaacattgaataattttgatagaggttcggcttaccgtggagcg
gaaggattttttgacctgagtaaaatcccggaagatattcgtgatgagcagatagaacag
tatctggcaaatcgttctgctgtagacggtatgttgccggctgtagtaactgaacttggt
tcaaattcaattgtggtgtacataggtggtgtaggtgaaagcagaattagcggtagtagt
tataactggattaaacgaaccattaataatgcgaaactggatgacgctgccgtacgtgtg
ggctcagtagtacatgtacgaggtgatggtaagagttatcgaattgtacagcagccggag
cttcagggggcgattgttgctctggatgctcagactggagctgtaaaagctttggtaggt
ggttatgatttttatcgtcgaagttttaaccgtgtgactcaggccaaacgtcagcctggt
tcttcttttaagccttttatttattcagcagctattgctaaaggcttcacgccggcgacg
gtggtaaatgatgctccgattgttatgccgggaatgggtgcaggcgggcgtgcttggaca
cctaaaaactcagacggtcgttatgctgggtttatcacgttacgtcaggccttaactgca
tccaaaaatatggtttcaatccgtatactgatggctatgggtgttgactatgccagacaa
tatgtccagcattttggttttcgtctggatcagattccgaatagtctatccatggcactt
ggcagtggtgaggtaacgccaatgcagatggctgaaggttatgctatttttgctaatggt
ggttttaaagtttccaattatgtgattgaccggatttatgacagtcgtggtaacctgcgt
gcgcaaatgcaaccattagttgctaagcaaaatgcgccacaggctattgatccgcgcaat
gcattcattttatatcacatgatgatggatgtagttaatcatggtactgcttatagtgca
cacgcacttgggcgtagcgatattgcaggtaaaacgggtacaactaatgataataaggat
gcttggttcgtaggctttaatccgaacatcgttagcgcagtttatataggatatgatcgt
ccgcgcagtatggggcgttcagcctttgggggtacaattgctgtaccggtatggctggaa
tatatgcgttatgcattaaaaggtaaacctatagttaatacacctgttccagctggtatt
attcagaaatccggagaatattttcttaaagaacatcagacaactaatcctgatttgcca
ttggataatcgtgctgacggaccggtaacggccaaaacgaatggtaaaagtggtgatgtt
gatgatgctggagaagtaccagttgtccccaaatctggtactaatagtcagttagactca
ttattttaa

DBGET integrated database retrieval system