KEGG   Snodgrassella alvi: SALWKB2_1480Help
Entry
SALWKB2_1480      CDS       T03063                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
salv  Snodgrassella alvi
Brite
KEGG Orthology (KO) [BR:salv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SALWKB2_1480
Enzymes [BR:salv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SALWKB2_1480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored DAO Thi4 FAD_binding_3 HI0933_like NAD_binding_8 K_oxygenase YAcAr Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AHN28862
UniProt: X2HCR5
LinkDB All DBs
Position
complement(1655781..1657349)
Genome map
AA seq 522 aa AA seqDB search
MLDDTLKNQLKAYLEYVTRPVEIIATLDESKGARDMLALLQEVEALSDKVSLRTDGQSER
KPSFEITNPGVHTGLVFAGNPMGHEFSSLVLALLQVGGHPSKEAESLQQQIKNLQGSYHF
ETYYSITCHNCPDVIQALNLMSILNPNISHTAIDGALFQEEIEAKQIMGVPAVFLNGEPF
GQGRMELAEIVAKLDSNAASAAVDELNAKAPFDVLIVGGGPAGAAAAVYAARKGIRTGIV
AERFGGQVLDTLDIENYISVLRTDGPRFAHDLESHVRSYDVDIMNLQRVSALVPAKTTGG
LIEVHTESGAVLKSRTVILSTGAHWRSMNVPGEQEYRTKGVTYCPHCDGPLFKGKDVAVI
GGGNSGAEAAIDLAGVVKHVTLLEFSGKMRADEVLQQKLHSLPNVQIIMNAQTTEVTGEN
GKVNGLNYLDRVSNTEHHLALEGIFVQIGLLPNTGFLQGTVDLTEPMHEIVIDAFGKTSV
PGVFAAGDCTNVPYKQIIIAAGEGAKAALSAFDYLIRTSAAN
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgacactttgaaaaaccaactaaaagcttatcttgaatatgtaaccagaccg
gttgaaataattgctacgctggacgaaagtaaaggtgctcgcgacatgctggcactgtta
caggaagtagaggcgttaagcgataaagtcagtctgcgtaccgatggtcagtctgaacgt
aagccatcttttgaaatcactaatcccggtgtgcatacaggactggtttttgccggtaat
ccgatggggcatgaattcagttcactggtactggctttattgcaggtgggcggtcatcca
tctaaagaagcagaatcattacagcaacaaattaaaaatttgcagggcagttatcacttc
gaaacttattattctattacctgtcacaattgtccggatgttatacaggcattgaatctg
atgtctattctcaatccgaatatcagccatacagctattgacggagcattgtttcaggaa
gaaattgaagcgaaacagattatgggtgtgccggccgtttttctgaatggtgaaccattt
ggtcagggcagaatggaactggcggaaattgttgctaaactggacagcaatgccgccagt
gcggcagttgatgaattaaatgcaaaagcaccgtttgacgtgctgattgtgggcggggga
cctgccggtgctgctgccgctgtatatgcagcacgtaaaggtattcgtaccggtattgtg
gccgaacgttttggtggtcaggttctcgacacgctggatattgaaaattacatatcagtt
ttacgtaccgacggtccgcgttttgcccatgatctggaaagccacgtacgcagttatgat
gtcgatattatgaatttgcaaagagttagtgcgctggtaccggctaaaactacaggcgga
ctgattgaagtacatacagaaagtggtgctgttttaaaatcgcgtacagttatcctgtct
acaggtgcacactggcgctcaatgaatgtgcccggtgagcaggaataccgtacgaaaggt
gtgacttattgtccgcattgtgatggcccgttattcaaaggcaaagatgtagccgtaatt
ggtggtggtaattccggtgcagaagctgccattgatctggctggcgttgttaagcatgtt
actctgctggagttttccggcaaaatgcgtgctgatgaagtattacagcaaaaattgcat
agtctgcctaatgttcagattattatgaatgctcagactacagaggtaaccggcgaaaac
ggcaaagttaatggtctgaattatctggatcgggtaagcaatacagagcatcatctggca
ttggaaggtatttttgttcagattggtttattaccgaataccggatttttgcaaggtaca
gtagacttaactgagccaatgcacgagattgtaatcgatgcttttggtaaaaccagtgtg
ccgggtgtttttgccgccggtgactgtacaaacgtaccctataagcagattattattgct
gccggtgaaggtgctaaagcggcattaagtgcttttgattatctgattcgtaccagtgca
gctaattaa

DBGET integrated database retrieval system