KEGG   Salinivibrio sp. YCSC6: E8E00_01075Help
Entry
E8E00_01075       CDS       T05946                                 

Definition
(GenBank) ribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
saly  Salinivibrio sp. YCSC6
Pathway
saly03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:saly00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    E8E00_01075
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:saly03019]
    E8E00_01075
   03016 Transfer RNA biogenesis [BR:saly03016]
    E8E00_01075
Enzymes [BR:saly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     E8E00_01075
Messenger RNA biogenesis [BR:saly03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     E8E00_01075
Transfer RNA biogenesis [BR:saly03016]
 Prokaryotic type
  tRNA degradation factors
   E8E00_01075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB CSD2 OB_RNB S1 HTH_12 OB_Dis3 RNase_II_C_S1 Tricorn_C1
Motif
Other DBs
NCBI-ProteinID: QCF34883
LinkDB All DBs
Position
I:233504..235999
Genome map
AA seq 831 aa AA seqDB search
MSQDTGSTKNTPTGIAADPHQAREAEKYDNPVPSREHLLEVVRSFKAPVSRDNLFAHLGL
AGDEQYEGLRRRLRAMERDGQLVFTRRQCYALPERLDLVKGTVIGHRDGFGFLRPEGKGN
HDDWMLPHHQMRSVMHGDVILAQGVGTDKRGRKEARVVRVLEARQGQIVGRYFVEDGMGF
VVPDDSRLGQDIVIDKEQTQGARMGNVVVVEIMQRPTRQTNPVGKIVEVLGENMAPGMEI
EIAMRTHDIPHQWPDAVLKQVKSLSEEVPEKAKEGRVDLRDLPLVTIDGEDARDFDDAVY
CERKRSGGWRLWVAIADVSYYVRPDSALDKEAQNRGNSVYFPNQVVPMLPEVLSNGLCSL
NPQVDRLCMVCEMTISESGALSGYKHYEAVMNSHARLTYTKVSHILEGDEELRERYRSLV
PHLETLHDMYKVLSEARQQRGAIEFETVETQFIFNAQRKIDRIVPVERNDAHKIIEECMI
LANIASARFVEKHKEPALYRVHEAPGEERLSGFKDFLGELGLSLSGGLEPTPKDYAALMH
VVHGRADSELIQTMLLRSMKQAVYQADNQGHFGLALKQYAHFTSPIRRYPDLLLHRALKY
LIAKQAGKNQDRWTPTGGYHYSFDDMDVLGEQCSKTERRADDATRDVADWLKCEYMQDHV
GDELEGVIANVTGFGFFVRLNELHIDGLVHISNLDNDYYRFDMVGQRLVGEGSGRVFRLG
DQVTVKVLAVNLDERQIDFELVGSERKARRPGKTARDKRKKGRAESNKDPQARRERMSVR
QQLKRGAVPSVEEDKAPAEKKGKKGKGKSPAEKARKKKAKKQKPKAVKKKK
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagacacaggttcgacaaaaaatacgcccacaggcattgcggccgatccgcac
caagctcgtgaagcagaaaaatatgacaatcccgtccctagccgtgaacacctgcttgag
gtcgtacgcagctttaaagcgccggtaagtcgagacaatctgttcgcacacttggggctc
gccggtgatgaacagtatgaaggcttacgtcgacgcctgcgcgctatggagcgtgatggc
caattggtgtttacccgtcgtcagtgctacgccttacccgagcgattagacttggttaaa
ggcactgtcatcggtcaccgagacggctttggctttctgcgcccagaaggcaaaggcaat
cacgatgattggatgttaccgcaccatcaaatgcgtagcgtgatgcacggtgatgtgatt
ttggcacaaggtgttggcaccgataagcgaggccgcaaagaagcccgtgtagtacgggtg
ctcgaggcacgccaaggtcaaatcgtgggccgttactttgtggaagatggcatgggcttt
gtcgtgcccgatgatagccgtcttggtcaagacatcgtgatcgacaaagagcaaacccaa
ggtgcgcgtatgggcaatgtggtggtggtcgagatcatgcagcgcccgactcgacaaacc
aatcctgtcggtaagattgttgaagtgctgggcgagaacatggcgcccggcatggaaatc
gaaattgcgatgcgcacccacgatattccccaccaatggccggatgcggtcctcaagcaa
gtgaaaagcttgagtgaggaagtaccagaaaaagccaaagagggccgcgtcgatctacgt
gatttgccactggtgaccatcgatggtgaagatgcccgcgactttgatgatgcggtctat
tgcgagcgtaaacgctcgggcggctggcgtctgtgggtggcgattgccgatgtcagctac
tatgtgcgacctgattcggcgttggataaagaagcgcaaaaccgcggtaactcggtgtac
ttcccgaatcaagtggtgcccatgttgccggaagtgctctccaatggtttatgctcgctg
aacccgcaagtcgatcgcttgtgtatggtgtgtgagatgacgatttctgagtcaggtgcg
ttatctggttacaagcattacgaagcggtgatgaattcccacgcgcgtctgacctatacc
aaggtctctcacatccttgaaggcgatgaggagttgcgtgagcgctaccgttctctggta
ccgcacttagagaccttgcacgatatgtacaaagtgctcagtgaggctcgccaacaacgg
ggggcgattgagttcgagacggtggaaacccagtttattttcaacgcacagcgtaaaatc
gaccgtattgtgccggtggagcgtaacgatgcgcacaagatcatcgaagagtgtatgatc
ttggccaatatcgcgtcggcgcgttttgtggaaaaacacaaagagccagcactctatcgt
gtccacgaagcgccgggcgaagagcgcctcagtggctttaaagatttcttaggcgagtta
ggcttgagtctcagcggcggccttgagccgacgccgaaagactacgcggcactgatgcat
gtggtacatggtcgcgctgacagtgaactgatccaaaccatgttgctccgctcgatgaag
caagcggtgtatcaagcggataaccaaggccacttcggtttggcactcaagcaatatgca
cactttacctcgcctattcgtcgctatccggatttgctgttgcaccgtgcactcaaatac
ttgattgccaaacaagcgggtaaaaaccaagaccgttggaccccgaccggtggctaccat
tactcatttgacgatatggatgtgctcggcgagcagtgttcgaaaaccgaacgccgtgct
gatgatgctacccgtgatgtggctgattggcttaagtgcgaatacatgcaagatcacgtt
ggtgatgagttggaaggcgtgattgccaatgtcactggttttggcttctttgttcgcctc
aatgagttacacatcgacggtttggtccatatttccaaccttgataatgattactatcgc
tttgatatggtgggtcaacgcttggtcggtgaaggctcgggacgcgtgttccgactcggt
gatcaggtgaccgtgaaagtcttagccgttaacttggatgagcgacaaatcgactttgag
ctggtaggctctgagcgcaaagcccgtcgcccggggaaaacagcccgtgacaaacgcaag
aaaggccgtgcggagtcgaataaagacccacaagcccgtcgtgagcgaatgtccgtgcgt
cagcaactgaaacgtggcgccgtgcctagcgttgaagaagacaaggcccctgcagagaaa
aaaggcaagaagggcaaaggtaagtcgcctgcggaaaaagcacgcaagaaaaaggcgaag
aagcaaaaacctaaagcggtcaagaaaaagaagtaa

DBGET integrated database retrieval system