KEGG   Salinivibrio sp. YCSC6: E8E00_02200Help
Entry
E8E00_02200       CDS       T05946                                 

Gene name
pnp
Definition
(GenBank) polyribonucleotide nucleotidyltransferase
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
saly  Salinivibrio sp. YCSC6
Pathway
saly03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:saly00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    E8E00_02200 (pnp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:saly03019]
    E8E00_02200 (pnp)
   03016 Transfer RNA biogenesis [BR:saly03016]
    E8E00_02200 (pnp)
Enzymes [BR:saly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     E8E00_02200 (pnp)
Messenger RNA biogenesis [BR:saly03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     E8E00_02200 (pnp)
Transfer RNA biogenesis [BR:saly03016]
 Prokaryotic type
  tRNA degradation factors
   E8E00_02200 (pnp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH PNPase RNase_PH_C S1 KH_1 KH_2 S1_2 Cauli_DNA-bind
Motif
Other DBs
NCBI-ProteinID: QCF35082
LinkDB All DBs
Position
I:complement(509412..511547)
Genome map
AA seq 711 aa AA seqDB search
MNPIVKTFQYGNHTVTLETGVMARQATGAVMASMDDTSVFVSVVGKKEAAEGQGFFPLTV
NYQERTYAAGKIPGGFFKREGRPSESETLTARLIDRPIRPLFPDSFKNEVQVIATVVSVN
PAVSPDVVAMLGTSAALAISGIPFNGPIGAARVGYINDELVLNPSEAELDNSRLDLVVAG
TEGAVLMVESEADRLSEEQMLQAVMFGHDQQQVAINAIKEFAAEVGTPAWDWQAPEVNAA
LQARVAEMAQGPLAQAYQITEKMARYEQVGNVKQEVVAALLEQDETLDEREILDMLGDLE
KKVVRSRIIAGEPRIDGREKDMVRALDVRTGVLPRTHGSALFTRGETQALVTATLGTQRD
AQIIDSIMGERQDSFMLHYNFPPYCVGETGFVGSPKRREIGHGRLAKRGIAAVMPSQDEF
PYTVRVVSEITESNGSSSMASVCGTSLALMDAGVPVKKSVAGIAMGLVKEGDDFVVLSDI
LGDEDHLGDMDFKVAGTDDGVTALQMDIKIEGITKEIMQIALNQAKGARLHILDVMDQAI
GSARDDISEFAPRIHTISINPDKIRDVIGKGGAVIRQLTEETGTTIEIDDDGTVKIAATD
GAAAQDAISRIEALTAEVEVGRIYTGKVQRIVDFGAFVSVIGGKDGLVHISQIADQRVEK
VSDFLEIGQEVEVKVLEIDRQGRIRLSMKEAASDKAATEAAPADDAPATDA
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccaatcgtaaaaacattccaatacggcaaccataccgtgacgttggaaaccggt
gtgatggctcgccaagccaccggtgcggtaatggcaagcatggacgatacctcagtattc
gtctctgtcgtcggtaaaaaagaagcggcagaaggccaaggcttcttcccactgaccgtg
aactaccaagagcgtacttacgcggcaggtaaaatcccaggtggtttcttcaagcgtgaa
ggtcgtccttcagagtcagaaaccctgacagcacgtttgattgaccgccctattcgtccg
cttttccctgactcgttcaaaaacgaagttcaagtgattgcgaccgtagtatcggtaaac
ccagctgttagcccagatgtggttgccatgctaggtacctctgcggcactggcgatttct
ggtatcccattcaatggcccaatcggtgcagcacgtgttggttatatcaacgatgagctg
gtattgaacccaagcgaagcagagctggacaacagccgtcttgaccttgtggttgccggt
actgaaggcgcggtgctgatggttgaatctgaagccgatcgcctaagcgaagaacaaatg
ctgcaagcggtgatgtttggtcatgaccaacaacaagtcgctatcaacgctattaaagag
ttcgccgcggaagttggtacccctgcgtgggattggcaagcaccagaagtgaatgctgcc
ctgcaagcgcgtgtcgcagaaatggcgcaaggcccactcgcacaagcgtaccaaatcact
gaaaaaatggcgcgttatgagcaagtcggtaacgtgaagcaagaggtggttgccgctctg
cttgagcaagacgagaccctcgacgagcgtgaaatcctcgatatgcttggcgacctagag
aaaaaagtcgtgcgtagccgcatcattgccggcgagccacgtatcgatggccgcgaaaaa
gacatggttcgtgcgctagacgtacgtaccggtgtgctacctcgcacacacggcagcgcg
ttgttcacgcgtggtgaaacgcaggcgctggtgaccgccacactgggtacccaacgtgat
gcacagatcatcgactcaatcatgggtgagcgtcaggacagctttatgctgcactacaac
ttccctccatactgtgtcggtgaaacaggttttgtcggttcaccaaagcgtcgtgaaatc
ggccatggccgtctcgcgaaacgtggtatcgctgcggtaatgccaagccaagacgaattc
ccatacaccgtccgtgtggtctctgagatcactgagtcaaacggctcatcgtcaatggcg
tcggtatgtggtacctctctggcactgatggacgccggtgtaccggtgaaaaaatcagtc
gcgggtatcgcgatgggtctggttaaagaaggggacgattttgtcgtactttctgacatc
ctcggtgatgaagaccaccttggcgacatggactttaaagtcgcgggtaccgatgacggt
gtgactgcactgcagatggacatcaaaatcgaaggtatcaccaaagagatcatgcaaatc
gctctaaaccaagcaaaaggtgcgcgtctgcatatcttggatgtgatggatcaagcgatt
ggttcagcgcgcgatgatatctctgagtttgcgccacgtattcacaccatcagcatcaac
ccagataagatccgtgatgtgatcggtaaaggtggcgcggtgatccgtcagctaaccgaa
gaaaccggcaccacaatcgaaatcgatgacgacggtacggtgaaaattgctgcaactgac
ggcgcggcggcacaagatgcgatttctcgtatcgaagccttgaccgctgaagtggaagtg
ggccgcatctacacgggtaaagtccagcgtatcgttgatttcggtgcgttcgtgtctgtg
atcggtggtaaagatggtctggtacacatctcgcaaatcgcagatcagcgcgttgagaaa
gtctctgacttcctcgaaatcggccaagaagtcgaagtgaaagtgctagagatcgaccgc
caaggtcgtatccgtctaagcatgaaagaagcggcttcggataaagcagccactgaggct
gcacctgccgatgatgcacctgcaactgacgcttag

DBGET integrated database retrieval system