KEGG   Salinivibrio sp. YCSC6: E8E00_12765Help
Entry
E8E00_12765       CDS       T05946                                 

Definition
(GenBank) ribonuclease PH
  KO
K00989  ribonuclease PH [EC:2.7.7.56]
Organism
saly  Salinivibrio sp. YCSC6
Brite
KEGG Orthology (KO) [BR:saly00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:saly03016]
    E8E00_12765
Enzymes [BR:saly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.56  tRNA nucleotidyltransferase
     E8E00_12765
Transfer RNA biogenesis [BR:saly03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    E8E00_12765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH RNase_PH_C Lipoprotein_2
Motif
Other DBs
NCBI-ProteinID: QCF36960
LinkDB All DBs
Position
I:complement(2734849..2735568)
Genome map
AA seq 239 aa AA seqDB search
MRPSGRALDQIRPVSFTRGFTAHAEGSVLVCFGDTKVICNATVEEGVPRFLKGKGQGWVT
AEYGMLPRATHTRNRREASTGKQGGRTMEIQRLIARSLRAAVDLTALGEYTITVDCDVIQ
ADGGTRTASISGASVALADALNAMVRDGKLAANPMKGHVAAVSVGIYQQTPICDLEYVED
SAADTDMNVVMLEDGRMIEVQGTAEAEPFTPDELNAMLVLAKKGIDDIVVAQKSALADA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccaagtggaagagcgctcgaccaaattcgtcccgttagctttacccgcggtttt
actgcccacgcagaaggctctgtgctggtttgctttggcgacacaaaagtcatttgtaac
gccactgtcgaagagggtgtgccacgctttttaaaaggcaagggccaaggctgggtgacg
gcagaatatggtatgttgccacgtgccacgcatacgcgtaatcgtcgagaagcgtcgacc
ggtaaacaaggcggccgcacgatggaaattcagcgtctgatcgcgcgcagcctgcgtgcc
gcggttgatttaaccgcgctgggtgagtacaccatcacggttgattgtgatgtgattcag
gccgacggcggcacgcgtactgcatctatttcgggggcgagcgttgcactggctgacgca
cttaatgccatggtgcgtgatggcaaacttgccgcgaaccccatgaaaggtcacgttgca
gcggtgtcggtgggtatttatcagcaaacgccaatttgcgatctggaatatgtagaagac
tccgcggcagacaccgacatgaatgtggtgatgctcgaagatggccgcatgattgaggta
caaggtaccgctgaggcagagccatttacccccgatgagctcaatgccatgttggtactg
gccaagaagggcattgatgacattgtcgttgcccaaaaatcggcgttagccgacgcataa

DBGET integrated database retrieval system