KEGG   Salinivibrio sp. YCSC6: E8E00_15370Help
Entry
E8E00_15370       CDS       T05946                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
saly  Salinivibrio sp. YCSC6
Pathway
saly00564  Glycerophospholipid metabolism
saly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saly00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    E8E00_15370
Enzymes [BR:saly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     E8E00_15370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 K_oxygenase Pyr_redox_2 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: QCF37590
LinkDB All DBs
Position
II:complement(331042..332583)
Genome map
AA seq 513 aa AA seqDB search
MTTPTTHNETLLDILVVGGGINGAGIAADAAGRGLNVGLYDAKDFASATSSASSKLIHGG
LRYLEHYEFRLVSEALAEREVLINKAPHIAFPMRFRLPHRSYLRPAWMIRCGLFLYDHLG
KRSTLPSSHKVNLAKTGYMKDEMKIGFEYSDAWVDDARLTLLNAQYTREKGGEVRNYCQV
VAAERENTIWRVTLEDTHTGERFERKAKALVNATGPWVKQFYDDSLHEKSPRGIRMIKGS
HIVVPRIHQDPQAYILQNNDGRIVFVIPYLDKFSLIGTTDVEHKADPRAAKIDDAEVDYL
VDVVNQHFTKQLSRDDVVWSYSGVRPLCDDESDSPQAITRDYTIELEQQGNQAPLVSIFG
GKLTTYRKLAESAMRKLAPFFDKMGQPWTANGALPGGDFSCTREQLAASFMQRYPWLAQV
TAQRFADTYGTRTHQMLAGCHSEADMGRRFADGVYQAELNYLIKYEFVQHAEDALWRRTK
LGLYLSEEQQAAIADYIEQQRGSLRTVPLSEAS
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgactacgccaactactcataacgaaactttactcgatattctggtcgtcggaggaggc
atcaatggtgcgggtatcgctgccgatgcagcaggccgtggtctgaacgtcggcctgtac
gacgcaaaagattttgcgtcagcgacgtcttctgcaagctctaagctaatccacggcggc
ttgcgctatttggagcattacgagttccgccttgtgtctgaagccttggctgagcgcgaa
gtcttgatcaacaaagcgccgcacattgctttcccaatgcgctttcgtttgccgcaccgc
tcctatttgcgtcccgcgtggatgattcgttgtggtctgtttctctatgaccatcttggt
aaacgctctacgttgcccagcagccataaagtgaatctggccaaaactgggtatatgaaa
gacgaaatgaagattggcttcgaatattcggatgcatgggtggatgatgcgcgcctgaca
ttgctaaatgcgcaatacacccgcgagaaaggcggcgaagtgcgtaactactgccaagtg
gtcgcggcagagcgtgagaatacgatttggcgtgtcaccttggaagatacccacacggga
gagcgattcgagcgtaaagcgaaagccttggtgaatgcgacaggcccgtgggttaagcag
ttttatgatgatagcctgcacgagaaatcaccgcgtggtattcgtatgattaaaggatca
cacattgtggtgccacgcattcatcaagacccacaggcgtacatcttgcagaacaacgat
ggtcgcattgtgtttgtaatcccttatttggataaattctcgctgattggcaccacagac
gtggaacacaaagccgatccgcgtgcggcgaaaattgatgatgccgaagtggattatttg
gtcgatgtggttaaccagcactttaccaaacaattgtctcgagacgatgtcgtttggagc
tacagcggtgtgcgtccattgtgtgatgatgagtctgattcaccgcaggcgatcacacgg
gattacaccattgaactggagcaacagggcaatcaagcgccgctcgtatcgattttcggt
ggtaaactcaccacttaccggaagttggcagagtcagccatgcgtaaactggcgcctttc
tttgacaagatgggtcagccttggaccgcaaatggtgcgctaccgggcggcgactttagc
tgcacacgcgaacagttggcagcatcgtttatgcagcgttatccttggttagcgcaagtg
acggcacaacgttttgcagatacgtatggcacacgtacacaccaaatgctcgctggctgt
catagcgaagcggacatgggtcgtcgatttgcagacggtgtgtatcaggcggagctgaac
tatctgattaagtatgagtttgttcagcatgccgaagatgcattatggcgtcgtaccaaa
cttggcttgtatctctccgaagaacaacaagccgcgattgcggattatattgagcaacag
cgaggcagtttgcgtaccgtgcccctcagtgaagcgagctaa

DBGET integrated database retrieval system