KEGG   Salinivibrio sp. YCSC6: E8E00_16745Help
Entry
E8E00_16745       CDS       T05946                                 

Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
saly  Salinivibrio sp. YCSC6
Brite
KEGG Orthology (KO) [BR:saly00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:saly03016]
    E8E00_16745
Enzymes [BR:saly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     E8E00_16745
Transfer RNA biogenesis [BR:saly03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    E8E00_16745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2
Motif
Other DBs
NCBI-ProteinID: QCF37831
LinkDB All DBs
Position
II:complement(649684..651666)
Genome map
AA seq 660 aa AA seqDB search
MFQDNPLLAQLKQQIQETLPKKEGTVKATEKGFGFLEVDDKTSLFIPPPYMKKVMHGDRV
EAFVRTEKEREVAEPDALIEQSIDRFIGRVQWIRNRLNIVPDHPQIKDAIRAKTQRGLSQ
DELKDGDWVVASLIRHPLKGDDNFFCQVSEKITDANDKIAPWWVTLAKHNLPNQEPAPKE
AWAMLEQGLERRDLTALPFVTIDSESTKDMDDALYVKANEQGGFTMTVAIADPTAYIDAD
DDLDQVARSRGFTIYLPGRNIPMLPRDLSDDLCSLRAHEKRPALCCTFNIAADGTIADDA
EFFSAWIQSHGQLAYDKVSDYIEQGEQAAWQPESSDIADQIHQLHQFALARIEWRETHAV
TFPDRPDYRFELSEDNDVIAIHTDARRIANRIVEEAMISANICAGRKLRESFGFGIFNTH
AGFNSDKLDDVVELVKAHEGEADSESLATVEGFSALRRWLNSLDSTYLDNRLRRFQAYSE
IGHEPAPHYAMGLDVYATWTSPIRKYGDMINHRLLKASIRGESEANAPADTVGEELAGHR
KHHRMAERDVADWLYVRLLKPEVEAQTRYTAEIFDINRAGMRVRLLENGAPAFIPSSLII
DNKTRIACDKETGTVTIDGNVEFKLGDSLEVVIADIKESTRSIVAKPTQVFALPEQAKEE
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaagacaatcccctgctagcgcaacttaagcaacagatccaagaaaccctgccc
aagaaagagggaacggtgaaagccactgaaaaaggctttggctttttagaagtggacgat
aaaaccagcctctttattccaccaccgtatatgaagaaagtgatgcacggtgatcgtgtt
gaagccttcgttcgcacagaaaaagagcgtgaggtcgcagagccggatgccttgattgag
caaagcattgaccgctttattggtcgcgttcagtggattcgtaaccgtctcaatattgtc
ccggatcatccgcaaatcaaagatgctatccgcgccaaaacccagcgcggcttatcgcaa
gacgaacttaaagatggcgactgggttgtcgcatccctgatccgtcacccactcaaaggc
gacgacaacttcttctgccaagtcagtgaaaaaatcaccgatgccaatgacaagattgcg
ccttggtgggtcacgctagcaaaacataacttaccaaaccaagagcctgcgcctaaagaa
gcatgggcgatgttggagcaaggtttagagcgccgcgatctgaccgcgctccccttcgtg
accattgatagcgaatcgaccaaagatatggacgatgcgttatatgtaaaagccaacgag
caaggcggctttaccatgacagtcgcgattgccgatccgactgcgtatatcgatgcggat
gacgaccttgaccaagtggcccgcagccgcggctttacgatttacttgcccggtcgcaat
atcccaatgttgcctcgcgatctgagtgacgatttgtgttcactacgtgcccacgagaaa
cgtccggcgctttgctgtaccttcaatatcgctgccgatggcaccattgccgatgacgcc
gagtttttctcagcatggatccaatcacacggccagctagcctacgacaaggtgtctgac
tacatcgagcaaggtgaacaagcagcatggcagccagagagcagcgacatcgcggatcaa
atccatcagttgcatcagtttgcacttgctcgcattgaatggcgtgaaacgcatgcggtg
accttccccgatcgtccagactatcgctttgaactcagcgaagataacgatgtgatcgcg
attcacactgacgcgcgccgcatcgctaaccgtatcgttgaagaggcgatgatcagcgct
aacatttgtgcgggtcgcaaactgcgtgaatcgttcggtttcggtatttttaacacccac
gcaggctttaacagtgacaagctggacgatgtggtcgagttggtcaaagcccatgaagga
gaagccgatagcgaaagtttggcaaccgttgaaggctttagcgcattgcgtcgttggtta
aacagcctcgacagcacgtatctcgacaaccgcctgcgtcgtttccaagcgtacagtgaa
attggtcacgagccagctcctcactacgcgatgggccttgatgtctacgctacatggaca
tcgcctatccgtaagtacggcgatatgattaaccaccgcttactcaaagcgagcattcgc
ggcgaaagcgaagctaatgcccctgcggatacggtcggtgaagaactggctggtcatcgc
aaacaccaccgcatggccgagcgcgatgtcgctgattggctgtacgtccgtttgttgaag
ccagaagtggaagcacaaacccgttacacagcggaaatctttgatattaatcgcgcgggt
atgcgtgttcgcctactcgaaaatggcgcaccggcgtttatcccatcgtcgctgatcatc
gataacaaaacccgcattgcctgtgataaagaaactggcacagtgaccattgatggcaac
gttgagtttaagcttggcgacagcctagaagtggtgattgcggatatcaaagaatccacg
cgctctattgtggcaaaaccaacccaagtgtttgcgctgcctgagcaagcgaaagaagaa
taa

DBGET integrated database retrieval system