KEGG   Salmonella sp. SSDFZ69: EOS98_00345Help
Entry
EOS98_00345       CDS       T06160                                 

Definition
(GenBank) PTS sugar transporter subunit IIC
  KO
K17466  D-glucosaminate PTS system EIIC component
Organism
salz  Salmonella sp. SSDFZ69
Pathway
salz00030  Pentose phosphate pathway
salz01120  Microbial metabolism in diverse environments
salz02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:salz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EOS98_00345
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    EOS98_00345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:salz02000]
    EOS98_00345
Transporters [BR:salz02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   D-Glucosaminate-specific II component
    EOS98_00345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EII-Sor
Motif
Other DBs
NCBI-ProteinID: AZY96138
LinkDB All DBs
Position
69963..70712
Genome map
AA seq 249 aa AA seqDB search
MDTLLFASLMGLYYWFARLRLGYTFSAMLLQPVVIAVFVGLLLGNMQTAMIIGAGMQLVY
LGVTSTPGGNVPSDPALAACISIPIAVKAGMDPNLAIALAIPFGVIGVFLDQLRRTLNAA
WVHMADKHAETANMAGIMRCAFLYPALLGLVLRFPVVFAANYFGQDVVESFLKLMPHWLT
HSFEIMGGILPALGFAITIMVIGKKSLLPWFIGGFFAVLYLKVDIMAMAIFGTCVAFLIK
GLAKNEGAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggataccttactctttgcaagcctgatggggttgtattactggtttgcccgtttacgc
ctcggctacaccttctccgcgatgctgttacaaccggtggtgatcgcggtatttgtcggg
cttttgcttggcaatatgcagaccgcgatgatcatcggcgcagggatgcagctcgtttat
ttgggcgtgacctcaacgccgggcggcaacgtgccgtcggacccggcgctggcggcctgt
atctccattcctatcgcggtgaaggccggtatggacccaaacctggcgatcgcgctggca
atcccgtttggcgtgattggcgtgtttctcgatcagcttaggcgcacgctgaacgccgcc
tgggtgcatatggcggataaacacgcggaaacggcaaacatggcgggcatcatgcgttgc
gcctttctttacccggcattgctggggctggtgctgcgcttcccggtggtctttgccgct
aactactttggccaagatgtggtggaaagtttccttaaactgatgccgcactggttaacc
cactcctttgaaatcatgggcggcattctgccggcgctgggctttgccatcaccattatg
gtgatcggtaaaaagagcctgttgccgtggtttatcggcgggttcttcgcggtgttatac
ctcaaggtcgacatcatggcgatggccatcttcggcacctgtgtcgccttcctgattaaa
ggcctggcgaaaaatgaaggagcagcatga

DBGET integrated database retrieval system