KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1031Help
Entry
MW1031            CDS       T00086                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00020  Citrate cycle (TCA cycle)
sam00190  Oxidative phosphorylation
sam00650  Butanoate metabolism
sam01100  Metabolic pathways
sam01110  Biosynthesis of secondary metabolites
sam01120  Microbial metabolism in diverse environments
sam01130  Biosynthesis of antibiotics
sam01200  Carbon metabolism
Module
sam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MW1031 (sdhA)
   00650 Butanoate metabolism
    MW1031 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MW1031 (sdhA)
Enzymes [BR:sam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MW1031 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     MW1031 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAB94896
NITE: MW1031
UniProt: A0A0H3JW07
LinkDB All DBs
Position
1129260..1131026
Genome map
AA seq 588 aa AA seqDB search
MAEKHLIVVGGGLAGLMSTIKAAEKGAHVDLFSVVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLANQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
HHRTAYAGATTGQQLLYALDEQVRAYEVDGLVTKYEGWEFLGIVKGDDDSARGIVAQNMT
TAEIETFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAIYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCINQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIKGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAIDYISNIDRSYTDM
DESIFEKRKAEEQERFDKLLAMRGTENAYKLHRELGEIMTANVTVVRENEKLLETDKKIV
ELMKRYEDIDMEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
NDEEWLKTTMASFQGAFEKPQFTYDDVDVSLIPPRKRDYTSKSKGGKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacatcttattgttgtcggaggtggcctagcgggcttaatgtcaacaatt
aaagcggcagaaaaaggtgcacatgtagatttgttctcagttgtaccagtaaagcgttcg
cactctgtttgtgcccaaggtggcattaatggtgcggtcaatactaaaggggaaggcgat
tctccttggattcactttgatgatacagtgtatggtggcgacttccttgcaaaccaacca
cctgttaaagcgatgacagaggcagcacctaaaattattcatttattagaccgtatgggc
gtaatgttcaatagaacaaatgaaggtctattagattttagacgtttcggtggtacatta
catcacagaacagcatatgcaggggcaacaactggacaacaattattatatgcattggat
gaacaagttcgtgcatatgaagtagatggattagttacgaagtatgaaggatgggaattc
cttggcatagttaaaggtgacgatgatagtgcaagaggtatcgttgcacaaaatatgaca
actgctgagattgaaacatttggttcagatgcagttattatggcaacgggtggccctggt
attattttcggtaaaacaacaaactcgatgattaatacaggatcagcggcttccattgtt
taccaacaaggcgctatttatgctaatggtgagttcattcaaattcatcctactgcaatc
cctggtgatgataaactgcgactaatgagtgaatcagcacgtggtgaaggtggacgaatt
tggacatataaagatggtaagccttggtacttcttagaagagaaatatcctgattatggt
aacttagtacctcgtgatatcgcaacgcgtgaaattttcgatgtatgtattaaccaaaaa
ttaggtataaatggcgaaaacatggtatatcttgatttgtcacataaagatccacatgag
ttagatgtaaaactaggtggtatcattgagatttatgaaaaattcactggtgatgaccca
cgcaaagtaccaatgaagattttcccagctgttcactattcaatgggtggtctatatgta
gattatgatcaaatgacaaatattaaagggttatttgcagctggagaatgtgacttctct
caacatggtggtaaccgcttaggtgccaattcattgttatcagcgatttatggtggtaca
gtagcaggtccaaacgcgattgattatatttcaaatattgatcgatcatatactgatatg
gacgaaagtatttttgaaaaacgtaaagctgaagagcaagaacgttttgataaattatta
gctatgcgcggtacagaaaatgcctataaattacaccgtgaacttggtgaaattatgaca
gcaaatgtaactgttgttcgtgaaaatgaaaaactgttagaaacagataaaaagattgtt
gaattgatgaaacgttatgaagatattgatatggaagatactcaaacttggagtaaccaa
gcggtattctttacccgtcaactatggaacatgttagtacttgcacgtgttattacgatt
ggtgcatataaccgtaacgaatcacgcggtgcccattataaaccagaattcccagagcgt
aatgatgaagagtggttaaaaacgacaatggcctcattccaaggcgcatttgaaaaacca
cagtttacttatgatgacgtcgatgtgagtttaataccacctcgtaaacgtgattacaca
agtaagtctaaagggggtaaaaaataa

DBGET integrated database retrieval system