KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1032Help
Entry
MW1032            CDS       T00086                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00020  Citrate cycle (TCA cycle)
sam00190  Oxidative phosphorylation
sam00650  Butanoate metabolism
sam01100  Metabolic pathways
sam01110  Biosynthesis of secondary metabolites
sam01120  Microbial metabolism in diverse environments
sam01130  Biosynthesis of antibiotics
sam01200  Carbon metabolism
Module
sam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MW1032 (sdhB)
   00650 Butanoate metabolism
    MW1032 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MW1032 (sdhB)
Enzymes [BR:sam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MW1032 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     MW1032 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_9 Fer4_10 Fer4_17 Fer4_2 Fer4_16 Fer4_15 Fer4 Fer4_13 Fer4_21 Fer4_6 Fer4_4 Fer4_18
Motif
Other DBs
NCBI-ProteinID: BAB94897
NITE: MW1032
UniProt: A0A0H3JVR1
LinkDB All DBs
Position
1131026..1131841
Genome map
AA seq 271 aa AA seqDB search
MTEQSVKNTPQHETQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
RNPVNIKGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaatcagtgaaaaacactccacaacatgaaacacaatctaaaccgaaacaa
aaaacagtaaaattaattattaaacgacaagatacaagtgattctaagccttatgaagaa
acatttgaaattccatatcgtgaaaatttaaacgtcattgcttgtttaatggaaattaga
cgtaacccagttaatattaaaggtgaaaaaacaacacctgttgtctgggatatgaactgc
ttagaagaagtatgtggagcatgttctatggttatcaatggtcgtgcaagacaatcttgt
tctgcgattgttgatcaattagaacaacctattcgtttagagccaatgaatactttccca
gttatccgtgacttacaagttgatcgttctagaatgttcgataacttaaaacgtatgaaa
gcatggatcccaattgatggaacgtatgatttaggtccgggaccacgtatgccagagaaa
aaacgtcaaacagcttatgaattatctaaatgtatgacatgtggtgtatgtttagaggtt
tgtcctaatgttactgaaaataataaattcgttggtgcgcaagcaatctcgcaagttcgt
ttgtttaatttgcacccaacaggatctatgactaaagatgaacgtttaaatgcattaatg
ggtactggtggcttacagcagtgtggtaattcacaaaactgtgttaatgcttgccctaaa
ggtattccattaacaacatccattgcagcaatgaacagagaaacaacattccacatgttt
aaatcattctttggttcagaccatgaagtagaataa

DBGET integrated database retrieval system