KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1103Help
Entry
MW1103            CDS       T00086                                 

Definition
(GenBank) ORFID:MW1103; hypothetical protein, similar to protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Brite
KEGG Orthology (KO) [BR:sam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sam01001]
    MW1103
Enzymes [BR:sam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MW1103
Protein kinases [BR:sam01001]
 Serine/threonine kinases: Other
  Bacterial family
   MW1103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Seadorna_VP7 RIO1 Sigma_reg_N ChlamPMP_M Choline_kinase Kinase-like Kdo ETRAMP PNPase
Motif
Other DBs
NCBI-ProteinID: BAB94968
NITE: MW1103
UniProt: A0A0H3JZV1
LinkDB All DBs
Structure
PDB: 

Position
1202183..1204177
Genome map
AA seq 664 aa AA seqDB search
MIGKIINERYKIVDKLGGGGMSTVYLAEDTILNIKVAIKAIFIPPREKEETLKRFEREVH
NSSQLSHQNIVSMIDVDEEDDCYYLVMEYIEGPTLSEYIESHGPLSVDTAINFTNQILDG
IKHAHDMRIVHRDIKPQNILIDSNKTLKIFDFGIAKALSETSLTQTNHVLGTVQYFSPEQ
AKGEATDECTDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDSVPNVTTDVRKDIPQS
LSNVILRATEKDKANRYKTIQEMKDDLSSVLHENRANEDVYELDKMKTIAVPLKKEDLAK
HISEHKSNQPKRETTQVPIVNGPAHHQQFQKPEGTVYEPKPKKKSTRKIVLLSLIFSLLM
IALVSFVAMAMFGNKYEETPDVIGKSVKEAEQIFNKNNLKLGKISRSYSDKYPENEIIKT
TPNTGERVERGDSVDVVISKGPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQA
PKGYIANQSVTANTEIAIHDSNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVES
KEEYSDDIDEGDVISQSPKGKSVDEGSTISFVVSKGKKSDSSDVKTTTESVDVPYTGKND
KSQKVKVYIKDKDNDGSTEKGSFDITSDQRIDIPLRIEKGKTASYIVKVDGKTVAEKEVS
YDDV
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgataggtaaaataataaatgaacgatataaaattgtagataagcttggcggcggtggc
atgagtaccgtttatcttgctgaagatacgatacttaacattaaagttgcaattaaggcg
atttttataccacctagagaaaaagaagaaacattaaaacgttttgaacgagaagtacat
aactcatcacagctatcacatcaaaatatagtaagtatgatcgatgttgatgaagaagat
gactgttactacttagtaatggaatatattgaaggtccgactttgtctgagtatattgaa
agtcatgggccattaagtgttgacacggcgattaattttacgaatcaaatattggatggt
attaaacatgcgcatgatatgcgtattgtacatagagatattaagccacaaaatatatta
attgacagcaataaaacgttgaaaatatttgattttggaattgctaaagctttaagtgag
acgtctttaactcagactaatcatgtgttaggtactgtgcagtacttttcgccagaacaa
gcaaaaggtgaggcaacggatgaatgtacagatatttattctataggtattgtgttatat
gaaatgcttgttggtgaaccaccctttaatggagaaactgcagttagcattgcgattaaa
catattcaggattctgtgccaaatgtgacaacagatgtacgtaaggatattccgcaatct
ttaagtaatgtcattttacgcgctacagaaaaagacaaagcgaatcgttacaaaacaatt
caagaaatgaaagatgatttgagtagtgttttacatgaaaatcgagcgaatgaagatgtc
tatgaactcgataaaatgaaaacgatagcggtacctttgaaaaaagaagatctagcaaag
catattagtgaacataagtcgaatcaacctaaacgtgaaacgacgcaagtacctattgta
aatgggcctgctcatcatcagcaattccaaaagccagaaggtacggtttacgaaccaaaa
cctaaaaagaaatcaacacgaaagattgtgctcttatcactaatcttttcgttgttaatg
attgcacttgtttcttttgtggcaatggcaatgtttggtaataaatacgaagagacacct
gatgtaatcgggaaatctgtaaaagaagcagagcaaatattcaataaaaacaacctgaaa
ttgggtaaaatttctagaagttatagtgataaatatcctgaaaatgaaattattaagaca
actcctaatacaggtgaacgtgttgaacgtggtgacagtgttgatgttgttatatcaaaa
ggccctgaaaaggttaaaatgccaaatgtcattggtttacctaaggaggaagccttgcag
aaattaaaatcgttaggtcttaaagatgttacgattgaaaaagtatataataatcaagcg
ccaaaaggatacattgcaaatcaaagtgtaaccgcaaatactgaaatcgctattcatgat
tctaatattaaactatatgaatctttaggcattaagcaagtttatgtagaagactttgag
cataaatcctttagcaaagctaaaaaagccttagaagaaaaagggtttaaagttgaaagt
aaggaagagtatagtgacgatattgatgagggtgatgtgatttctcaatctcctaaagga
aaatcagtagatgaggggtcaacgatttcatttgttgtttctaaaggtaaaaaaagtgac
tcatcagatgtcaaaacgacaactgaatcggtagatgtaccatacactggtaaaaatgat
aagtcacaaaaagttaaagtttatattaaagataaagataatgacggttcaactgaaaaa
ggtagtttcgacattactagtgatcaacgtatagacattcctttaagaattgaaaaagga
aaaacagcaagttatattgttaaagttgacggtaaaactgtagctgaaaaagaagtcagc
tatgatgatgtataa

DBGET integrated database retrieval system