KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW1840Help
Entry
MW1840            CDS       T00086                                 

Definition
(GenBank) glutamyl-tRNAGln amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00970  Aminoacyl-tRNA biosynthesis
sam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sam00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MW1840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sam03029]
    MW1840
Enzymes [BR:sam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MW1840
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MW1840
Mitochondrial biogenesis [BR:sam03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MW1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey MOZART1 YqeY
Motif
Other DBs
NCBI-ProteinID: BAB95705
NITE: MW1840
UniProt: P64202
LinkDB All DBs
Structure
PDB: 

Position
complement(2002605..2004032)
Genome map
AA seq 475 aa AA seqDB search
MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAM
RAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITR
LHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVS
DVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGE
IGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERK
AKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELL
DTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLK
FVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcattttgaaacagttataggacttgaagttcacgtagagttaaaaacggactcaaaa
atgttttctccatcaccagcgcattttggagcagaacctaactcaaatacaaatgttatc
gacttagcatatccaggtgtcttaccagttgttaataagcgtgcagtagactgggcaatg
cgtgctgcaatggcactaaatatggaaatcgcaacagaatctaagtttgaccgtaagaac
tatttctatccagataatccaaaagcatatcaaatttctcaatttgatcaaccaattggt
gaaaatggatatatcgatatcgaagtcgacggtgaaacaaaacgaatcggtattactcgt
cttcacatggaagaagatgctggtaagtcaacacataaaggtgagtattcattagttgac
ttgaaccgtcaaggtacaccgctaattgaaatcgtatctgaaccagatattcgttcacct
aaagaagcatatgcatatttagaaaaattgcgttcaattattcaatacactggtgtatca
gacgttaagatggaagagggatctttacgttgtgatgctaacatctctttacgtccatat
ggtcaagaaaaatttggtactaaagccgaattgaaaaacttaaactcatttaactatgta
cgtaaaggtttagaatatgaagaaaaacgccaagaagaagaattgttaaatggtggagaa
atcggacaagaaacacgtcgatttgatgaatctacaggtaaaacaattttaatgcgtgtt
aaagaaggttctgatgattaccgttacttcccagagcctgacattgtacctttatatatt
gatgatgcttggaaagagcgtgttcgtcagacaattcctgaattaccagatgaacgtaaa
gctaagtatgtaaatgaattaggtttacctgcatacgatgcacacgtattaacattgact
aaagaaatgtcagatttctttgaatcaacaattgaacacggtgcagatgttaaattaaca
tctaactggttaatgggtggcgtaaacgaatatttaaataaaaatcaagtagaattatta
gatactaaattaacaccagaaaatttagcaggtatgattaaacttatcgaagacggaaca
atgagcagtaaaattgcgaagaaagtcttcccagagttagcagctaaaggtggtaatgct
aaacagattatggaagataatggcttagttcaaatttctgatgaagcaacacttctaaaa
tttgtaaatgaagcattagacaataacgaacaatcagttgaagattacaaaaatggtaaa
ggcaaagctatgggcttcttagttggtcaaattatgaaagcgtctaaaggtcaagctaat
ccacaattagtaaatcaactattaaaacaagaattagataaaagataa

DBGET integrated database retrieval system