KEGG   Staphylococcus aureus subsp. aureus MW2 (CA-MRSA): MW2006Help
Entry
MW2006            CDS       T00086                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sam  Staphylococcus aureus subsp. aureus MW2 (CA-MRSA)
Pathway
sam00473  D-Alanine metabolism
sam00550  Peptidoglycan biosynthesis
sam01100  Metabolic pathways
sam01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MW2006 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MW2006 (ddlA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MW2006 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sam01011]
    MW2006 (ddlA)
Enzymes [BR:sam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MW2006 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:sam01011]
 Precursor biosynthesis
  Amino acid ligase
   MW2006 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 DUF2487
Motif
Other DBs
NCBI-ProteinID: BAB95871
NITE: MW2006
UniProt: Q8NVH8
LinkDB All DBs
Structure
PDB: 

Position
complement(2166020..2167090)
Genome map
AA seq 356 aa AA seqDB search
MTKENICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDWRKQNNITAEII
STDELHLENGEALEISQLLKESSSGQPYDAVFPLLHGPNGEDGTIQGLFEVLDVPYVGNG
VLSAASSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYEHNILKLVNDKLNYPVFVKPAN
LGSSVGISKCNNEAELKEGIKEAFQFDRKLVIEQGVNAREIEVAVLGNDYPEATWPGEVV
KDVAFYDYKSKYKDGKVQLQIPADLDEDVQLTLRNMALEAFKATDCSGLVRADFFVTEDN
QIYINETNAMPGFTAFSMYPKLWENMGLSYPELITKLIELAKERHQDKQKNKYKID
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaaatatttgtatcgtttttggagggaaaagtgcagaacacgaagtatcg
attctgacagcacaaaatgtattaaatgcaatagataaagacaaatatcatgttgatatc
atttatattaccaatgatggtgattggagaaagcaaaataatattacagctgaaattata
tctactgatgagcttcatttagaaaatggagaggcgcttgagatttcacagctattgaaa
gaaagtagttcaggacaaccatacgatgcagtattcccattattacatggtcctaatggt
gaagatggaacgattcaaggactttttgaagttttggatgtaccatatgtaggaaatggt
gtattgtcagctgcaagttctatggacaaacttgtaatgaaacaattatttgaacatcga
gggttaccacagttaccttatattagtttcttacgttctgaatatgaaaaatatgaacat
aacattttaaaattagtaaatgataaattaaattacccagtctttgttaaacctgctaac
ttagggtcaagtgtaggtatcagtaaatgtaataatgaagcggaacttaaagaaggtatt
aaagaagcattccaatttgaccgtaagcttgttatagaacaaggcgttaacgcacgtgaa
attgaagtagcagttttaggaaatgactatcctgaagcgacatggccaggtgaagtcgta
aaagatgtcgcgttttacgattacaaatcaaaatataaagatggtaaggttcaattacaa
attccagctgacttagacgaagatgttcaattaacgcttagaaatatggcattagaggca
ttcaaagcgacagattgttctggtttagtccgtgcagatttctttgtaacagaagacaac
caaatatatattaatgaaacaaatgcaatgcctggatttacggctttcagtatgtatcca
aagttatgggaaaatatgggcttatcttatccagaactgattacaaaacttatcgagctt
gctaaagaacgtcaccaggataaacagaaaaataaatacaaaattgactaa

DBGET integrated database retrieval system