KEGG   Streptomyces ambofaciens: SAM23877_0494Help
Entry
SAM23877_0494     CDS       T04055                                 

Definition
(GenBank) hypothetical protein
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00020  Citrate cycle (TCA cycle)
samb00190  Oxidative phosphorylation
samb00650  Butanoate metabolism
samb01100  Metabolic pathways
samb01110  Biosynthesis of secondary metabolites
samb01120  Microbial metabolism in diverse environments
samb01130  Biosynthesis of antibiotics
samb01200  Carbon metabolism
Module
samb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
samb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
samb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAM23877_0494
   00650 Butanoate metabolism
    SAM23877_0494
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SAM23877_0494
Enzymes [BR:samb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SAM23877_0494
    1.3.5.4  fumarate reductase (quinol)
     SAM23877_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_binding_3 DAO HI0933_like GIDA NAD_binding_7 Pyr_redox_3 ApbA AlaDh_PNT_C adh_short
Motif
Other DBs
NCBI-ProteinID: AKZ53543
UniProt: A3KI93
LinkDB All DBs
Position
complement(461563..463293)
Genome map
AA seq 576 aa AA seqDB search
MAITEQRLSTSVLVIGTGGAGLRAAIELAEAGTDVLAVGKRPKEDAHTALAAGGINAALA
TMDPEDSWQQHAADTLKESYLLADPRTVEIVTRGAALGIDDLERYGMAFAREDDGRISQR
FFGAHKFRRTAFAGDYTGLEIQRTLIRRADQLRIPVLDGVYITRLLVHDGAVFGAYGFGL
TDGRRYLIHADAVILAAGGHTRIWRRTSSRRDENTGDSFRLAVEAGARLRDPELVQFHPS
GIIEPENAAGTLVSEAARGEGGILRNALGERFMNRYDAERMELSTRDRVALASYTEIKEG
RGTPKGGVWLDVSHLPRQTIMNRLPRVYQTLLDLQMLDITREPIEIAPTAHYSMGGVWVR
HEDHSTDVRGLYAIGEASSGLHGANRLGGNSLIELLVFGRITGRAAAAYSESLTAQPRSA
AAVAQARAEIDDLLAADGPENVRALQRALRNTMTEHAGVVRDEQGLRAGLAELGVIERRM
EDVGVHPDIAGFQDLAHAFDLKSAALAARATLEAALERRETRGCHNRSDHPGMDPALQVN
LVWSPTAGITRESIAPIPEDIATLMEEVSAEGKLVE
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaccgaacaacgtctgtccacctcggtgctcgtgatcgggacgggcggcgcc
ggcctccgggcggccatcgagctcgccgaggcggggacggacgtcctggccgtgggcaag
cgtcccaaggaggacgcccacacggccctggccgcgggcggcatcaacgcggccctggcc
accatggaccccgaggacagctggcagcagcacgcggcggacaccctcaaggagagttac
ctgctcgccgacccgcggaccgtggagatcgtcaccaggggcgccgccctgggcatcgac
gacctggagcgctacggcatggccttcgccagggaggacgacggccgcatctcccagcgc
ttcttcggcgcgcacaagttccgccgcactgccttcgccggcgactacaccggcctggag
atccagcgcacgctcatcaggcgggccgaccagctccggatccccgtgctcgacggtgtg
tacatcacccggctcctggtgcacgacggcgcggtcttcggggcctacggcttcgggctc
acggacggacggcgctacctcatccacgccgacgccgtcatcctggcggcgggcggacac
acccgcatctggcggcgtacctcctcgcggcgcgacgagaacaccggtgactccttccgg
ctggccgtggaggccggagcccggctgcgcgacccggagctggtccagttccacccctcg
ggcatcatcgagccggagaacgcggccggcaccctcgtcagcgaggccgcgcggggcgag
ggcggcatcctgcgcaacgccctcggcgaacgcttcatgaaccgctacgacgccgaacgc
atggaactgtccacgcgcgaccgcgtcgccctcgcctcctacaccgagatcaaggaaggc
cggggcacgcccaagggcggcgtctggctcgacgtctcccacctgccccggcagacgatc
atgaatcggttgccccgggtgtaccagacgctcctggacctgcagatgctggacatcacc
cgcgagccgatcgagatagcgccgacggcgcactactcgatgggcggggtctgggtcagg
cacgaggaccacagcaccgacgtacgcggtctgtacgccatcggcgaggcgtccagcgga
ctgcacggcgccaaccggctgggcggcaacagcctcatcgagctgctggtcttcggacgt
atcacaggacgggcggcggccgcctactccgagtcgctgaccgcccagccgcgctcggcg
gcagcggtggcacaagcgcgtgcggagatcgacgacctgctcgcggcggacggaccggag
aacgtgcgcgcgcttcagcgcgccctacgcaacaccatgaccgagcacgcgggcgtcgtc
cgcgacgagcagggactgcgcgccggactggcggaactcggtgtgatcgagaggcgcatg
gaggacgtcggcgtccatccggacatcgccggcttccaggacctcgcgcacgccttcgac
ctgaagtccgccgccctcgcggcccgcgccaccctggaagcggccctcgaacgccgcgag
acccgtggctgccacaaccgcagcgaccacccgggaatggaccccgcactgcaggtcaac
ctggtgtggtccccgacggccggcatcacccgcgagagcatcgcgccgattcccgaggac
atcgcgactcttatggaggaggtgtccgccgaaggaaagctggtcgagtga

DBGET integrated database retrieval system