KEGG   Streptomyces ambofaciens: SAM23877_0795Help
Entry
SAM23877_0795     CDS       T04055                                 

Gene name
bbgII
Definition
(GenBank) Beta-galactosidase BbgII
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
samb  Streptomyces ambofaciens
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SAM23877_0795 (bbgII)
Enzymes [BR:samb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SAM23877_0795 (bbgII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Cellulase DUF3459 Glyco_hydro_35 Glyco_hydro_14 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: AKZ53844
UniProt: A3KJ17
LinkDB All DBs
Position
776158..778203
Genome map
AA seq 681 aa AA seqDB search
MISTLLSRLQDGADGAPVPRLGFGADYNPEQWPREVWEEDVRLMREAGVNIVSVGIFSWA
RLQPGPDVWDFAWLDDVMDLLHRNGVGVDLATATASPPPWLTTAHPEILPVTDRGETLWP
GARQHWRPTSPVFREHALRLVREMATRYAGHPALVAWHVNNELGCHNVYDFSDDAARAFR
DWLRARYTTLDALNHAWGTAFWSQRYSDWEQILPPRLAASHPNPTQQLDFKRFSSDALKD
HLRAERRVLRELTPDVPVTTNFMVMPGTKGMNYADWADEVDFVANDHYVVPSGRERDELS
FSANLTSGIAGGRPWFLMEHSTSAVNWQPVNLAKRPGELARDSLTHVAHGADAVCFFQWR
QSAAGAEKYHSAMVPHAGADSDLFRAVTALGDTLKALAPVAGSEREPAEVGILFDWESWW
ASEQDSHPTSLLDYHREALDWYSALLSLGVRADVVTTGADLSRHRMLIAPVLHLVPAELA
KDLTRYAEQGGHLVTTYFSGVVDENDHIWLGGYPGALRDLLGIRVEEFGPLPAGQSVELD
DASTGTLWTDHITVTAPRTEVLAGYRTGPHAGRPAVTRRAAGSGSAAYVSTRLGAEGLAS
LLPRLLEPAGVTSELPAAVHGSVEATVRRGPGGRFLFLVNRTDEAVTVPGLAGEVLVGAT
GGDGSVVLGPRDVAVLRTSAA
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgatctccaccctcctgtcccgtctccaggacggggcggacggtgcgcccgtcccccgt
ctgggcttcggcgccgactacaaccccgagcagtggccgagggaggtgtgggaggaggac
gtccggctgatgcgcgaggccggcgtgaacatcgtgtccgtgggcatcttctcctgggcc
cggctccagccggggcccgacgtctgggacttcgcctggctggacgacgtcatggacctg
ctgcaccgcaacggcgtaggggtcgacctcgccaccgccaccgcgtccccgccgccgtgg
ctgaccacggcgcatccggagatcctcccggtgaccgaccggggcgagacgctgtggccg
ggcgctcgccagcactggcgccccacctcgccggtcttccgcgagcacgccctgcgcctg
gtcagggagatggcgacccgctacgccggccatccggccctggtcgcctggcacgtcaac
aacgagctgggctgccacaacgtgtacgacttctcggacgacgcggcccgcgccttccgc
gactggctgcgcgcgcggtacaccacgctggacgccctcaaccacgcctggggtacggcg
ttctggtcgcagcgctacagcgactgggagcagatcctgccgccgcggctggcggcctcc
cacccgaacccgacccagcagctggacttcaagcgcttctcgtcggacgcgttgaaggac
cacctgcgcgcggagcgccgggtgctgcgggagctgaccccggacgtccccgtcaccacc
aacttcatggtgatgcccggcaccaagggcatgaactacgcggactgggcggacgaggtg
gacttcgtcgccaacgaccactacgtcgtgccgagcggccgggaacgcgacgagctgtcg
ttctcggcgaacctcaccagtgggatcgccggcggccggccctggttcctgatggagcac
tcgacgagcgcggtgaactggcagccggtcaacctggccaagcgaccgggtgagctggcc
cgggactcgctgacgcacgtggcccacggcgcggacgcggtctgcttcttccagtggcgc
cagtccgcggccggcgccgagaagtaccactcggcgatggtcccgcacgccggcgccgac
agcgacctgttccgcgcggtgaccgcgctcggcgacaccctgaaggccctggcgccggtc
gcgggcagcgagcgggagcccgccgaggtcggcatcctcttcgactgggagtcgtggtgg
gcgagcgagcaggactcgcaccccacgtcgctgctcgactaccaccgggaggcgctcgac
tggtactccgcgctgctctccctgggcgtccgcgccgacgtcgtcaccaccggcgccgac
ctgagccgccaccggatgctgatcgcgcccgtactgcacctggtcccggccgagctcgcc
aaggacctcacccgctacgccgagcagggcggccacctggtcaccacgtacttctccggt
gtcgtcgacgagaacgaccacatctggctcggcggctacccgggcgccctgcgggacctg
ctcggcatccgcgtcgaggagttcggcccgctgcccgccgggcagtccgtggagctggac
gacgcgagcaccggcaccctgtggaccgaccacatcacggtcaccgcaccgcggaccgag
gtgctggccggctaccgcaccggcccgcacgcgggccgcccggccgtcacccggcgcgcg
gccggcagcggttcggccgcctacgtctcgacgcggctcggcgccgagggtctggcctcg
ctgctgccgcggctgctcgaaccggccggggtgacgagcgagctgcccgccgccgtccac
ggatcggtggaggccaccgtgcggcgcggccccggcggccggttcctgttcctggtcaac
cggaccgacgaggccgtgaccgtccccgggctcgccggcgaggtcctggtgggcgccacc
ggaggcgacggctccgtcgtcctcggccccagggacgtcgccgtgctgcgcacgtccgcc
gcctga

DBGET integrated database retrieval system