KEGG   Streptomyces ambofaciens: SAM23877_1053Help
Entry
SAM23877_1053     CDS       T04055                                 

Definition
(GenBank) putative aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00250  Alanine, aspartate and glutamate metabolism
samb00410  beta-Alanine metabolism
samb00640  Propanoate metabolism
samb00650  Butanoate metabolism
samb01100  Metabolic pathways
samb01120  Microbial metabolism in diverse environments
Module
samb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAM23877_1053
   00650 Butanoate metabolism
    SAM23877_1053
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAM23877_1053
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAM23877_1053
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:samb01007]
    SAM23877_1053
Enzymes [BR:samb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SAM23877_1053
Amino acid related enzymes [BR:samb01007]
 Aminotransferase (transaminase)
  Class III
   SAM23877_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AKZ54102
UniProt: A3KJR3
LinkDB All DBs
Position
complement(1045707..1046975)
Genome map
AA seq 422 aa AA seqDB search
MTALSPHLRQATPVVAVRGEGVHLHGEDGRRYLDFTAGIGVTSTGHCHPRVVAAAREQVG
TLVHGQYTTVMHQPLRRLVDRLGEVLPTGLDSLFFTNSGSEAVEAALRLARQATGRPNVL
VCHGGFHGRTVAAASMTTSGTRFRSGFSPLMSGVVVTPFPTAFRYGWDEDTATRFALQEL
DYTLQTISAPADTAAVIVEPVLGEGGYVPASGAFMEGLRERADRHGFLLILDEVQTGVGR
TGRFWGHEHFGVTPDILITAKGLASGFPLSGIAAPDALMRRAWPGSQGGTYGANAVACAA
ACATLDVVRDEKLVENAEAMGARLRHGLEAVAARTPAIGDVRGMGLMLASEFVTEDGGPD
PETAARVQRAAVDEGLLLLLCGAWNQVVRMIPALVIDESAVDDGLRAWEAAVEAGTSGPV
DR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcactgtcgccgcaccttcgccaggccacgcccgtggtggccgtccggggcgag
ggcgtccacctccatggcgaggacggccgccgctacctggacttcaccgccggcatcggc
gtcaccagcaccgggcactgccaccccagggtcgtggccgccgcccgggaacaggtgggc
accctggtccacggtcagtacacgaccgtcatgcaccagccgctgcggcggctcgtcgac
cggctcggggaggtgctgcccaccggtctggacagcctgttcttcaccaactccggcagc
gaggcggtggaggcggcgctgcggctggcccgccaggccaccggccgacccaacgtgctg
gtgtgccacgggggtttccacggccggacggtcgccgccgcctccatgaccacctccggc
acccgcttccggtccggtttctcaccgctgatgagcggcgtggtcgtcacccccttcccg
acggccttccgctacggctgggacgaggacaccgccacccgcttcgccctccaggaactc
gactacaccctccagacgatctccgcgcccgccgacaccgccgccgtcatcgtggaaccg
gtgctcggcgagggcggctacgtgcccgcgagcggcgccttcatggagggtctgcgggaa
cgggcggaccggcacggcttcctgctgatcctggacgaggtgcagaccggcgtgggccgc
accggccgcttctggggccacgagcacttcggcgtcacccccgacatcctcatcaccgcc
aaggggctggccagcgggttcccgctgtccggcatcgccgcccccgacgcgctgatgcgc
agggcctggccgggctcgcagggtggcacgtacggcgccaacgcggtggcctgcgcggcg
gcctgcgccacgctcgacgtggtccgggacgagaagctcgtcgagaacgccgaggccatg
ggcgcgcggctgcggcacgggctggaggcggtggccgcgcggacgccggccatcggggac
gtgcgggggatggggctgatgctggccagtgagttcgtcaccgaggacggcggccccgac
ccggagaccgccgcccgggtccagcgcgccgccgtcgacgaaggactgctcctgctgctc
tgcggggcctggaaccaggtggtgcggatgatcccggccctggtgatcgacgagtccgcc
gtcgacgacggcctccgcgcctgggaggccgccgtcgaggccggcacctcgggaccggtg
gaccggtga

DBGET integrated database retrieval system