KEGG   Streptomyces ambofaciens: SAM23877_2313Help
Entry
SAM23877_2313     CDS       T04055                                 

Gene name
amy
Definition
(GenBank) Alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00500  Starch and sucrose metabolism
samb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:samb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAM23877_2313 (amy)
Enzymes [BR:samb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SAM23877_2313 (amy)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: AKZ55362
UniProt: A0A0K2ARA6
LinkDB All DBs
Position
complement(2416034..2417407)
Genome map
AA seq 457 aa AA seqDB search
MARRALTGAVALAAAALVMTPTSAQASPPGAKDVTAVLFEWNFASVARECTTTLGPAGYG
YVQVSPPAEHIQGGQWWTSYQPVSYKIAGRLGDRAAFKNMVDTCHAAGVKVVADAVVNHM
SAGSGTGTGGSSYGKYDYPGLYSSYDLDDCRSQIGNYQDRYNVQHCELVGLADLDTGEDY
VRGKIAGYLNDLLSLGVDGFRIDAAKHIPAADLAAVKSRLSNPGVYWKHEVIFGAGEAVQ
PGEYTGSGDVQEFRYASDLKRVFTNENLAYLKNYGEGWGYLSSGSAGVFVDNHDTERNGS
TLNYKSGANYTLANVFMLAWPYGAPDVNSGYEWSNHDAGPPNGGRVDACWQGGWKCQHAW
PEIRSMVAFRNATRGQAVTNWWDNGNDAIAFGRGSKGYVVVNHESGALTRTYQTSLPAGT
YCDVQSDKPVTVNGSGQFTATLGADTALALYAGKSAC
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcagagccctcacgggggccgtcgctctggcggcggccgcccttgtcatgacc
ccgacgtccgcccaggcctccccgcctggcgccaaggacgtcaccgccgtcctcttcgag
tggaacttcgcctccgtcgcccgggagtgcaccaccaccctcggccccgccggctacggc
tacgtccaggtctccccgcccgccgagcacatacagggcgggcagtggtggacctcctac
cagcccgtcagctacaagatcgccggccggctcggtgaccgcgccgccttcaagaacatg
gtggacacctgccacgcggccggtgtgaaggtcgtcgccgacgccgtggtcaaccacatg
tcggccggcagcggcaccgggaccggcggttcgtcgtacggcaagtacgactatccgggc
ctgtactcctcgtacgacctcgacgactgccgctcccagatcggcaactaccaggaccgg
tacaacgtccagcactgcgagctggtcggcctcgccgacctcgacaccggcgaggactac
gtccgcgggaagatcgccgggtacctgaacgacctgctctccctcggcgtcgacggcttc
cgcatcgacgcggccaagcacatcccggccgccgacctggccgccgtcaagtcccggttg
agcaacccgggcgtgtactggaagcacgaggtcatcttcggtgccggcgaggcggtgcag
cccggtgagtacaccggcagcggtgacgtccaggagttccggtacgcgtccgacctcaag
cgcgtcttcaccaacgagaacctcgcctacctgaagaactacggcgagggctgggggtat
ctgagcagcggttccgccggtgtcttcgtcgacaaccacgacaccgagcgcaacggctcc
acgctcaactacaagagcggcgcgaactacaccctcgccaacgtcttcatgctggcctgg
ccctacggcgcccccgacgtcaactccggctacgagtggtcgaaccacgacgccgggccg
ccgaacggcggtcgggtcgacgcctgctggcagggcggctggaagtgccagcacgcctgg
cccgagatcaggtcgatggtcgccttccgcaacgccacacgcggccaggcggtcacgaac
tggtgggacaacggcaacgacgccatcgccttcgggcgcggcagcaagggctacgtcgtc
gtcaaccacgagtcgggcgcgctcacccgcacctaccagacctcgctgccggcggggacg
tactgcgacgtccagagcgacaagccggtgaccgtgaacggctcgggccagttcaccgcg
accctcggcgccgacacggcgctggcgctgtacgccggaaagtccgcctgctga

DBGET integrated database retrieval system