KEGG   Streptomyces ambofaciens: SAM23877_3176Help
Entry
SAM23877_3176     CDS       T04055                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00620  Pyruvate metabolism
samb00680  Methane metabolism
samb01100  Metabolic pathways
samb01120  Microbial metabolism in diverse environments
samb01200  Carbon metabolism
Module
samb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAM23877_3176 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SAM23877_3176 (ppc)
Enzymes [BR:samb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SAM23877_3176 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKZ56225
UniProt: A0A0K2ASW9
LinkDB All DBs
Position
complement(3378863..3381598)
Genome map
AA seq 911 aa AA seqDB search
MSSADDQTTMTTSSELRADIRRLGDLLGETLVRQEGPELLELVEKVRRLTREDGEAAAEL
LRGTELETAAKLVRAFSTYFHLANVTEQVHRGRELGARRAAEGGLLARTADRLKDADPEH
LRDTVRNLNVRPVFTAHPTEAARRSVLNKLRRIAALLDTPVIESDRRRLDIRLAENIDLV
WQTDELRVVRPEPADEARNAIYYLDELHANAVGDVLEDLTAELERAGVKLPDDTRPLTFG
TWIGGDRDGNPNVTPQVTWDVLILQHEHGINDALEMIDELRGFLSNSIRYTGATEELLTS
LQADLERLPEISPRYKRLNAEEPYRLKATCIRQKLENTKQRLAKGTPHEAGHDYLGTAEL
LDDLRIVQTSLRAHRGGLFADGRLARTIRTLAAFGLQLATMDVREHADAHHHALGQLFDR
LGEESWRYADMPREYRAKLLAKELRSRRPLAPTPAPVDAAGEKTLGVFQTVKRALEVFGP
EVIESYIISMCQGADDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDELKAADTILED
LLSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRL
FHGRGGTVGRGGGPTHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVAA
TLQASALHTAPRQSDEALARWDAAMDVVSDAAHTSYRKLVEDPDLPTYFLASTPVDQLAD
LHLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWYGVGSGLKALREAGLDTVLDE
MHQQWHFFRNFISNVEMTLAKTDLRIAQHYVDTLVPDELKHVFDAIKAEHELTVAEVLRV
TGESELLDADPVLKQTFAIRDAYLDPISYLQVALLGRQREAAAAGEEADPLLARALLLTV
NGVAAGLRNTG
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagaccaccatgacgaccagcagcgagctgcgcgccgacatc
cgccggctgggtgatctcctcggagagaccctggtgcggcaggagggccccgagctgctg
gaactcgtcgagaaggtgcgccgactcacccgagaggacggcgaggccgccgccgagctg
ctgcgcggcaccgaactggagaccgcggccaagctggtccgcgccttctccacgtacttc
cacctcgccaacgtcaccgagcaggtccaccgcggccgggaactgggcgcccggcgcgcc
gccgagggaggactgctcgcgcgcaccgcggaccgcctgaaggacgccgaccccgagcac
ctgcgcgacaccgtccgcaacctcaacgtgcgccccgtcttcaccgcgcaccccaccgag
gccgcccgccgctccgtcctgaacaagctgcgccgcatcgccgccctcctggacaccccg
gtcatcgagtccgaccggcgccgcctggacatccgcctcgccgagaacatcgacctcgtg
tggcagaccgacgaactccgcgtcgtgcgccctgaacccgccgacgaggcgcgcaacgcc
atctactacctggacgagctccacgcgaacgccgtcggcgacgtcctggaggacctcacg
gcggagctggagcgagccggcgtcaagctccccgacgacacccgcccgctcaccttcggc
acctggatcggcggcgaccgcgacggcaaccccaacgtgaccccgcaggtcacctgggac
gtcctcatcctccagcacgagcacggcatcaacgacgccctggagatgatcgacgagctg
cgcggcttcctctccaactcgatccgctacaccggcgccaccgaggaactcctcacctcc
ctccaggccgacctcgagcggctccccgagatcagcccccgctacaagcgcctcaacgcg
gaggagccctaccggctcaaggcgacctgcatccggcagaagctggagaacaccaagcag
cgcctcgccaagggcaccccccacgaggccggccacgactacctgggcaccgccgagctc
ctggacgacctgcgcatcgtccagacctcgctgcgcgcccaccgcggcggcctcttcgcc
gacggccgcctcgcccgcaccatccgcacgctcgccgccttcggcctccagctcgccacc
atggacgtccgcgagcacgccgacgcccaccaccacgccctcggccagctcttcgaccgg
ctcggcgaggagtcctggcgctacgccgacatgccccgcgagtaccgcgccaagctgctc
gccaaggagctgcggtcccgccggccgctggcgcccaccccggcgcccgtcgacgccgcc
ggggagaagaccctcggcgtcttccagaccgtcaagcgcgcgctggaggtgttcggtccc
gaggtcatcgagtcctacatcatctcgatgtgccagggcgccgacgacgtcttcgcggcg
gcggtgctggcccgcgaggccggcctgatcgacctgcacgccggctgggcgaagatcggc
atcgtgccgctcctggagaccaccgacgagctcaaggccgccgacaccatcctggaggac
ctcctctccgacccctcctaccggcgcctggtcgccctgcgcggcgatgtccaggaggtc
atgctcggctactccgactcctccaagttcggcggcatcaccacctcgcagtgggagatc
caccgcgcccagcgccgcctgcgcgacgtcgcccaccgctacggcgtacgcctgcgcctc
ttccacggccgcggcggcaccgtcggccgcggcggcggccccacccacgacgcgatcctc
gcccagccctggggcaccctggagggcgagatcaaggtcaccgagcagggcgaggtcatc
tccgacaagtacctcatcccgtccctggcccgggagaacctggagctgaccgtcgcggcc
accctccaggcctccgcgctgcacaccgcgccccgccagtccgacgaggcactggcccgc
tgggacgccgcgatggacgtcgtctccgacgcggcccacacctcgtaccgcaagctggtc
gaggaccccgacctgcccacgtacttcctggcctccacgccggtcgaccagctcgccgac
ctgcacctgggctcgcggccctcccgccgccccggctcgggcgtctcgctcgacggactg
cgcgccatcccgtgggtgttcggctggacccagtcccggcagatcgtccccggctggtac
ggcgtcggctccggtctgaaggcactgcgcgaggcgggcctggacaccgtcctcgacgag
atgcaccagcagtggcacttcttccgcaacttcatctccaacgtcgagatgaccctcgcc
aagacggacctgcgcatcgcccagcactacgtcgacaccctggtgccggacgagctgaag
cacgtcttcgacgccatcaaggccgagcacgagctcaccgtcgccgaggtcctgcgggtc
accggcgagagtgaactgctggacgccgacccggtcctgaagcagaccttcgccatccgc
gacgcctacctcgacccgatctcctacctccaggtcgccctcctcggccgtcagcgcgag
gccgcggcggcgggcgaggaagccgacccgctgctcgcccgggccctcctgctcaccgtc
aacggtgtcgccgcgggcctgcgcaacaccggctga

DBGET integrated database retrieval system