KEGG   Streptomyces ambofaciens: SAM23877_4144Help
Entry
SAM23877_4144     CDS       T04055                                 

Gene name
yfmT
Definition
(GenBank) putative aldehyde dehydrogenase YfmT
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00010  Glycolysis / Gluconeogenesis
samb00053  Ascorbate and aldarate metabolism
samb00071  Fatty acid degradation
samb00280  Valine, leucine and isoleucine degradation
samb00310  Lysine degradation
samb00330  Arginine and proline metabolism
samb00340  Histidine metabolism
samb00380  Tryptophan metabolism
samb00410  beta-Alanine metabolism
samb00561  Glycerolipid metabolism
samb00620  Pyruvate metabolism
samb00625  Chloroalkane and chloroalkene degradation
samb00903  Limonene and pinene degradation
samb01100  Metabolic pathways
samb01110  Biosynthesis of secondary metabolites
samb01120  Microbial metabolism in diverse environments
samb01130  Biosynthesis of antibiotics
Module
samb_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAM23877_4144 (yfmT)
   00053 Ascorbate and aldarate metabolism
    SAM23877_4144 (yfmT)
   00620 Pyruvate metabolism
    SAM23877_4144 (yfmT)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAM23877_4144 (yfmT)
   00561 Glycerolipid metabolism
    SAM23877_4144 (yfmT)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAM23877_4144 (yfmT)
   00310 Lysine degradation
    SAM23877_4144 (yfmT)
   00330 Arginine and proline metabolism
    SAM23877_4144 (yfmT)
   00340 Histidine metabolism
    SAM23877_4144 (yfmT)
   00380 Tryptophan metabolism
    SAM23877_4144 (yfmT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAM23877_4144 (yfmT)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAM23877_4144 (yfmT)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAM23877_4144 (yfmT)
Enzymes [BR:samb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAM23877_4144 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AKZ57189
UniProt: A0A0K2AVZ5
LinkDB All DBs
Position
4399320..4400780
Genome map
AA seq 486 aa AA seqDB search
MSSYFTDLAQQYIDGEWRPGTGSWDIIDFNPYDNEKLASITIATVDEVDTAYRAAERAQK
QWAATNPYARRAVFEKVLRLVEDREAEISEAIIAELGGTRLKAAFELHLAKEFLREAVHL
ALRPEGRIIPSPVDGKENRVYRVPVGVVGVISPFNFPFLLSLKSVAPALALGNGVVLKPH
QNTPIVGGTLVGKLFEEAGLPGGLLNVVVTDIAEIGDAFLEHPVPKVISFTGSDKVGRHV
ATVCAAHFKRSILELGGNSALVVLDDADLDYAVDAAVFSRYVHQGQVCMAANRVLVDRSV
AEEFTEKFVAKVRTLKAGDPRDPSTVIGPLINSSQADAVTGVVEQALAEGATALVRGTVT
DNLVTPSVLTDVPADSALLRQEVFGPVAFLVTFDGEEEAVRLVNDTPYGLSGAVHTGDIE
RGVEFARRIDTGMFHVNDGTVHDEPIVPFGGEKHSGIGRLNGDTMLDAFTTQKWISVQHG
RSGFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgtacttcaccgacctcgcccagcagtacatcgacggcgagtggcgcccgggc
accggctcctgggacatcatcgacttcaacccgtacgacaacgagaagctggcctcgatc
accatagccacggtcgacgaggtcgacacggcgtaccgggcggccgagcgggcgcagaag
cagtgggcggcgacgaacccgtacgcgcgccgcgcggtgttcgagaaggtgctgcggctc
gtcgaggaccgcgaggcggagatcagcgaggcgatcatcgccgaactgggcggcacgcgc
ctgaaggccgccttcgagctgcacctcgccaaggagttcctgcgcgaggcggtccacctg
gcgctgcgccccgagggccggatcatcccctcgccggtcgacggcaaggagaaccgcgtc
taccgggtgccggtcggcgtggtgggcgtcatcagccccttcaacttccccttcctcctt
tccctgaagtcggtcgcgccggccctcgccctcggcaacggcgtcgtcctcaagccgcac
cagaacacgccgatcgtcggcggcacgctggtgggcaagctcttcgaggaggccggtctg
ccgggcgggctgctcaacgtcgtggtcaccgacatcgcggagatcggcgacgccttcctg
gagcacccggtcccgaaggtgatctccttcaccggctccgacaaggtcggccgccacgtc
gccaccgtctgcgccgcgcacttcaagcgctccatcctcgaactcggcggcaacagcgcc
ctcgtcgtcctcgacgacgccgacctcgactacgccgtcgacgccgccgtcttcagccgc
tacgtccaccagggccaggtctgcatggccgcgaaccgcgtcctggtcgaccggtcggtg
gccgaggagttcaccgagaagttcgtcgccaaggtcaggaccctcaaggccggcgacccg
cgcgacccgtcgaccgtcatcgggcccctgatcaactcctcgcaggcggacgccgtcacg
ggtgtcgtcgagcaggccctcgccgagggcgccaccgccctggtgcgcggcaccgtcacg
gacaacctcgtcacaccgtcggtcctcaccgacgtgcccgccgactcggcgctcctgcgg
caggaggtcttcggcccggtcgccttcctcgtcacgttcgacggcgaggaggaggcggtc
cgcctcgtcaacgacaccccgtacggcctgagcggcgccgtgcacaccggtgacatcgag
cgcggcgtcgagttcgccaggcgcatcgacaccggcatgttccacgtgaacgacgggacc
gtgcacgacgagccgatcgtgcccttcggcggggagaagcactccggcatcggccgcctg
aacggcgacaccatgctggacgccttcaccacccagaagtggatctcggtgcagcacggg
cggagcggcttcccgttctag

DBGET integrated database retrieval system