KEGG   Streptomyces ambofaciens: SAM23877_4639Help
Entry
SAM23877_4639     CDS       T04055                                 

Gene name
mdh
Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00020  Citrate cycle (TCA cycle)
samb00270  Cysteine and methionine metabolism
samb00620  Pyruvate metabolism
samb00630  Glyoxylate and dicarboxylate metabolism
samb00680  Methane metabolism
samb01100  Metabolic pathways
samb01110  Biosynthesis of secondary metabolites
samb01120  Microbial metabolism in diverse environments
samb01130  Biosynthesis of antibiotics
samb01200  Carbon metabolism
Module
samb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
samb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
samb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAM23877_4639 (mdh)
   00620 Pyruvate metabolism
    SAM23877_4639 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    SAM23877_4639 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    SAM23877_4639 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAM23877_4639 (mdh)
Enzymes [BR:samb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SAM23877_4639 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AKZ57684
UniProt: A0A0K2AXC7
LinkDB All DBs
Position
4915416..4916405
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVKLRLLEITPALNAAAGTAMELDD
CAFPLLQGIEITDDPNVAFDGANVALLVGARPRSKGMERGDLLEANGGIFKPQGKAINDH
AADDIKVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRALTQLAKKTGSSVTDIK
RLTIWGNHSATQYPDIFNATIAGKNAAEVVDDEKWLAEDFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVHTWVNGTADGDWASMGIPSDGSYGVPEGLISSFPVTCKDGKYEIVQGLE
INDFSRARIDASVKELSEERDAVRGLGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtgaacgtcaccgtcaccggcgcggccggccagatcggttacgcc
ctgctcttccgcatcgcctccggccagctgctcggcgcggacgtgccggtcaagctccgc
ctcctggagatcaccccggcgctcaacgccgccgcgggcaccgcgatggagctggacgac
tgcgcgttcccgctgctccagggcatcgagatcaccgacgacccgaacgtcgccttcgac
ggtgccaacgtcgccctcctcgtgggcgcccgcccgcgcagcaagggcatggagcgcggt
gacctcctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gccgcggacgacatcaaggtgctcgtggtcggcaacccggccaacaccaacgccctgatc
gcccaggccgccgccccggacgtaccggccgagcgcttcaccgcgatgacgcgcctggac
cacaaccgcgcgctgacccagctcgcgaagaagacgggctcgtcggtcaccgacatcaag
cgcctgaccatctggggcaaccactccgccacccagtacccggacatcttcaacgccacc
atcgccggcaagaacgccgccgaggtcgtcgacgacgagaagtggctggccgaggacttc
atcccgaccgtcgccaagcgcggcgccgccatcatcgaggcccgcggcgcctcgtcggcc
gcctccgccgccaacgccgccatcgaccacgtccacacctgggtcaacggcaccgccgac
ggcgactgggcctccatgggcatcccgtcggacggctcctacggcgtcccggagggcctc
atctcctccttcccggtcacctgcaaggacggcaagtacgagatcgtccagggcctggag
atcaacgacttctcccgcgcccgcatcgacgcctccgtcaaggagctgtcggaggagcgc
gacgcggtccgcggtctcggcctcatctga

DBGET integrated database retrieval system