KEGG   Streptomyces ambofaciens: SAM23877_5630
Entry
SAM23877_5630     CDS       T04055                                 

Gene name
srm7
Definition
(GenBank) putative NDP-aminohexose N-dimethyltransferase
  KO
K13307  dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.235]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00523  Polyketide sugar unit biosynthesis
samb01100  Metabolic pathways
samb01110  Biosynthesis of secondary metabolites
Module
samb_M00796  dTDP-D-mycaminose biosynthesis
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SAM23877_5630 (srm7)
Enzymes [BR:samb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.235  dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     SAM23877_5630 (srm7)
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 MetW Methyltransf_2 NodS Ubie_methyltran DUF938
Other DBs
NCBI-ProteinID: AKZ58675
UniProt: A0A0K2AZX1
LinkDB
Position
6051145..6051855
AA seq 236 aa
MYADDIAAVYDLVHEGKGKDYRQEAEEIAALVRVHRPGARTLLDVACGTGQHLHHLDGLF
DHVEGLELSADMLALATGRNPGVTFHQGDMRSFSLGRRFDAVTCMFSSIGHLRTTDELDS
TLRAFTDHLEPSGVIVVEPWWFPESFTPGYVGASITEAGERTVCRVSHSVREGNATRIEV
HYLLAGPGGVRHLTEDHTITLFPRADYEAAFERAGCDVVYQEGGPSGRGLFIGTRR
NT seq 711 nt   +upstreamnt  +downstreamnt
atgtacgccgacgacatcgcggccgtctacgacctggtccacgaggggaaggggaaggac
taccggcaggaggccgaggagatcgccgcactcgtgcgcgtccaccggccgggcgcccgg
accctgctcgacgtggcctgcggcaccggccagcacctgcaccacctggacggcctcttc
gaccacgtcgagggcctggaactctccgccgacatgctggccctcgcgaccggccggaac
cccggtgtcaccttccaccaaggggacatgcgctcgttctccctgggacgccggttcgac
gcggtgacctgcatgttcagctccataggccacctgcggaccaccgacgaactcgacagc
acgctgcgggccttcaccgaccacctcgaaccgtccggcgtcatcgtcgtcgaaccctgg
tggttccccgagtccttcacccccggttacgtcggcgccagcatcacggaggcgggcgag
cgcaccgtctgccgggtctcgcactccgtacgggaggggaacgccacccgcatcgaggtg
cactacctcctcgccggacccggcggcgtccgtcacctgaccgaggaccacaccatcacc
ctgttcccgcgcgccgactacgaggcggccttcgagcgcgccggctgcgacgtggtctac
caggaaggcggcccgtccggtcgcgggctgttcatcggcacccgccgctga

DBGET integrated database retrieval system