KEGG   Streptomyces ambofaciens: SAM23877_6361Help
Entry
SAM23877_6361     CDS       T04055                                 

Gene name
ligC
Definition
(GenBank) DNA ligase C2
Organism
samb  Streptomyces ambofaciens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AKZ59406
UniProt: A0A0K2B2M8
LinkDB All DBs
Position
complement(6855268..6856335)
Genome map
AA seq 355 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPDMHYEAKWDGFRSIVFRDGAEVEFGSRTGKPLTRYFPE
LVEAVRERLPQRCVVDGEIVIAREGHLDFDALTERIHPADSRVRMLAERTPASLVVFDLL
ALDDESLIEVGLTDRRARLVRALSGVTPPVHVAPATDDIEVARQWFEQYEGAGLDGVVAK
PLDLRYRQDERAMYKIKHERTADVVVAGYRLHKSGPVVGSLLLGLYDGEGALQHVGVSAA
FTMKRRAELVEELEPLRMDDVRGHPWAAWAEESAHESARLPGAPSRWSGKKDLSWVPLRP
ERVVEVAYDHMENGARFRHTARFRRWRPDRTPSSCTYAQLEEPVRYDLAEILGGP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcccgtcatgccgcccgtgaagccgatgctcgccaagtccgtggcgaagatc
ccgccggacatgcactacgaggccaagtgggacgggttccggtcgatcgtgttccgcgac
ggcgccgaggtcgagttcggcagccgcacgggcaagccgctgaccaggtacttcccggag
ctggtggaggcggtgcgggagcgtttgccccagcggtgcgtggtggacggggagatcgtg
atcgcacgggaggggcacctggacttcgacgcgctcaccgagcggatccatccggccgac
tcccgggtgcggatgctcgccgagcggacgccggcctcgctggtggtcttcgacctgctg
gcactggacgacgagtcactgatcgaagtggggctcaccgaccggcgggcgcggctggtc
cgggcgctgtccggggtcacgccgcccgtgcacgtggcgccggcgacggacgacatcgag
gtggcccggcagtggttcgagcagtacgagggggcggggctcgacggtgtcgtggccaag
ccgctcgacctgcgctaccgccaggacgagcgggccatgtacaagatcaagcacgagcgt
acggcggacgtggtcgtcgccggttaccgcctccacaagagcggtcccgtggtcggctcg
ctgctgctcggcctctacgacggcgagggcgccctccagcacgtgggggtgagcgccgcc
ttcaccatgaagcggcgtgccgagctggtggaggagctggagcccttgcgcatggacgac
gtgcggggtcatccgtgggcggcctgggccgaggagtcggcgcacgagtcggcccggctg
cccggcgctcccagccgctggtcgggcaagaaggacctctcctgggtgccgctgcggccg
gagcgggtcgtggaggtggcgtacgaccacatggagaacggggcgcgcttccgtcatacg
gcccgcttccggcgctggcgcccggaccggacaccctccagctgcacctacgcccagctg
gaggagccggtccgctacgacctcgcggagatcctcggcggcccttga

DBGET integrated database retrieval system