KEGG   Sinorhizobium americanum: SAMCFNEI73_Ch2067Help
Entry
SAMCFNEI73_Ch2067 CDS       T04621                                 

Gene name
dme
Definition
(GenBank) NAD-dependent malic enzyme Dme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
same  Sinorhizobium americanum
Pathway
same00620  Pyruvate metabolism
same00710  Carbon fixation in photosynthetic organisms
same01100  Metabolic pathways
same01120  Microbial metabolism in diverse environments
same01200  Carbon metabolism
Module
same_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:same00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAMCFNEI73_Ch2067 (dme)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SAMCFNEI73_Ch2067 (dme)
Enzymes [BR:same01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     SAMCFNEI73_Ch2067 (dme)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: APG91353
UniProt: A0A1L3LMT9
LinkDB All DBs
Position
2057593..2059905
Genome map
AA seq 770 aa AA seqDB search
MTTGDKAKPQSAPASGDIDQQALFFHRYPRPGKLEIQPTKPLGNQRDLALAYSPGVAAPC
LAIRDDPESAADFTARSNLVAVVSNGTAVLGLGNIGPLASKPVMEGKAVLFKKFAGIDVF
DIEIDAPTVERMVDVVSALEPTFGGINLEDIKAPECFEVERRLREKMDIPVFHDDQHGTA
IIVAAAVLNGLELAGKDIAKAKIVASGAGAAALACLNLLVTLGAKRENIWVHDLEGLVYK
GREVLMDEWKAVYARDSANRVLADSIGGADVFLGLSAAGVLKPELLAQMAEKPLIMALAN
PTPEIMPEVARAARPDAMICTGRSDFPNQVNNVLCFPHIFRGALDCGARTINEEMKMAAV
RAIAGLAREEPSDVAARAYSGETPVFGPDYLIPSPFDQRLILRIAPAVAKAAAESGVATR
PIQDFDAYLDKLNRFVFRSGFIMKPVFAAAKNAPKNRVIFAEGEDERVLRAAQVLLEEGT
AKPILIGRPQIIETRLRRYGLRIRPDVDFEVVNPEGDPRYRDYVEEYFTLVGRLGVIPEA
ARTIVRTNTTVIGALAVKRGEADALICGVEGRYSRHLRDVSQIIGKKPGVLDFSALSLLI
SQRGATFFTDTYVSFSPSAEEIAQTTVMAAGEIRRFGITPRAALVSHSNFGSRESESAAK
MRAALKIVRELAPDLEVDGEMHGDAAISETLRERVMPNSTLKGEANLLVFPNLDAANITL
GVVKTMTDSLHVGPILLGSALPAHILSPSVTSRGVVNMAALAVVEASHPA
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgggcgacaaagcgaaacctcaatcggctccggcgagcggagacatcgaccag
caggcactcttcttccaccgctacccccgcccgggcaagctcgagatccagcccaccaag
ccgctcggcaaccagcgcgatctggcgctcgcctattcgcccggcgtcgccgccccctgc
cttgccatcagggacgacccggagagcgccgccgatttcaccgcccgctcgaacctcgtc
gccgtcgtctcgaacggcaccgccgtgctcggcctcggcaatatcggtcccctcgcctcc
aagccggtcatggaaggcaaggcggtcctcttcaagaaattcgccggcatcgatgtcttc
gatatcgagatcgacgcaccaaccgtcgaacgcatggtcgacgtggtttccgcgctggag
ccgaccttcggcggcatcaatctcgaagacatcaaggccccggaatgtttcgaggtcgag
cgccgcctgcgcgagaagatggacattcccgtcttccatgacgaccagcacggaacagcg
atcatcgtcgccgccgccgtcctgaacggcctggaactcgccggcaaggacatcgccaaa
gcgaagatcgtcgcctcgggcgccggcgccgcggcccttgcctgcctcaaccttctcgtc
accctcggcgccaagcgcgaaaacatctgggtccatgacctcgagggcctcgtctacaag
ggccgcgaggttctgatggacgaatggaaggcggtctacgcacgggacagcgccaatcgc
gtgcttgccgacagcatcggcggcgccgacgtcttcctggggctttcggcggccggcgtc
ctcaagcccgaactgctcgcccagatggccgagaagccgctgatcatggcgctcgccaac
ccgacgccggaaatcatgccggaagttgcccgcgcggcccggccggatgcgatgatctgc
acgggacgctccgacttcccgaaccaagtcaacaacgttctctgcttcccgcatatcttc
cgcggcgcgctcgattgcggcgcgcgcaccattaacgaagagatgaagatggcggcggtg
cgggctatcgccggcctcgcgcgcgaggaaccgtcggatgtcgcggcccgtgcctattca
ggggaaacgccggtctttggacccgactacctcatcccctcgcccttcgaccagcggttg
atcctgcgcatcgccccggccgttgccaaggcggctgccgaaagcggcgtcgccacccgt
ccgatccaggatttcgacgcctatctcgacaagctcaaccgcttcgtcttccgctccggc
ttcatcatgaagccggttttcgcagccgccaagaacgccccgaagaaccgcgtcatcttc
gccgaaggggaagatgaacgggtattgcgcgccgcccaggtgctcctggaagaaggcacg
gccaagccgatcctgatcggccgcccgcagatcatcgaaacccgcctgcgccgctacggt
ctcagaattcgtcccgatgtcgacttcgaggtggtcaatccggaaggcgatccgcgctat
cgcgactacgtcgaggaatacttcacgctggtcggccgtctcggtgtcattccggaagcc
gcccgcacgatcgtgcgcacgaacacgacggtgatcggtgcgctggcagtcaagcgcggt
gaagcggacgcattgatctgcggcgtcgaagggcgctacagccgacacctgcgcgacgtt
tcgcagatcatcggcaagaagcccggcgtcctcgacttctcggcgctcagcctgttgatc
tcccagcgcggcgcgaccttcttcaccgacacctatgtgagcttcagccccagcgccgaa
gagatcgcccagacgaccgtgatggctgccggcgaaatacgccgctttgggatcacgccg
cgcgctgcgcttgtttcccattcgaatttcgggtcgcgcgaatccgagagcgccgccaag
atgcgcgccgcgctcaagatcgtccgcgagctggcgcccgatctcgaggtcgacggcgaa
atgcacggcgacgcggcgatctccgaaacactgcgcgagcgggtgatgccgaacagcacg
ttgaagggcgaagccaacctgctcgtcttccccaatctggacgccgccaacatcaccctc
ggtgtcgtcaagaccatgaccgacagcctccatgtcgggccgatcctgctcggctcggcg
ctgccggcccacatcctttctccctccgtcacttcccgcggcgtcgtcaacatggccgct
cttgcagtggtcgaggcaagccatcccgcctga

DBGET integrated database retrieval system