KEGG   Sinorhizobium americanum: SAMCFNEI73_Ch2306Help
Entry
SAMCFNEI73_Ch2306 CDS       T04621                                 

Gene name
fabI
Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
same  Sinorhizobium americanum
Pathway
same00061  Fatty acid biosynthesis
same00780  Biotin metabolism
same01100  Metabolic pathways
same01130  Biosynthesis of antibiotics
same01212  Fatty acid metabolism
Module
same_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:same00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAMCFNEI73_Ch2306 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SAMCFNEI73_Ch2306 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SAMCFNEI73_Ch2306 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:same01004]
    SAMCFNEI73_Ch2306 (fabI)
Enzymes [BR:same01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SAMCFNEI73_Ch2306 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SAMCFNEI73_Ch2306 (fabI)
Lipid biosynthesis proteins [BR:same01004]
 Fatty acid synthase
  Component type
   SAMCFNEI73_Ch2306 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: APG91587
UniProt: A0A1L3LNC1
LinkDB All DBs
Position
2291890..2292675
Genome map
AA seq 261 aa AA seqDB search
MSIPPVKAKLLEGRKGLVVGIANDRSIAWGCARAFRAFGAEVAITYLNDKARPHVEPLAR
ELEAAIFLPLDVAVPGQIEAVFERIAETWGELDFLVHSIAFSPKDALGGRVTDVSREGFL
TTMEISCWSFIRMAHLAEPLMKRGGTLFTMTYHGSQVVVENYNIMGVAKAALESAVRYIA
AELGPKGIRVHAISPGALATRAASGIPEFDALLEKTKVKSPTRELVDIDDVGVATAFLAH
EAARLITGQVLYVDGGYHIID
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtccattccccccgtaaaggccaagcttctcgaaggccgcaagggtctcgtcgtcggc
atcgccaacgaccgctcgattgcctggggctgcgcgcgtgcattccgggccttcggggcg
gaagtcgcgatcacctatctcaacgacaaagccaggccccatgtggagccgctggcgcgc
gagctcgaggccgcgatctttctgccgctggacgtcgccgtgcccggccagatcgaggct
gtcttcgagcgcatcgcggagacctggggagagctcgacttcctcgtccactcgatcgcc
ttttcgccgaaggatgcgctcggcgggcgggtgaccgatgtctcccgcgagggcttcctg
acgacgatggaaatctcctgctggtccttcatccgcatggcgcacttggccgaaccgctg
atgaagcgcggcgggactctcttcacgatgacgtatcacggctcgcaggtggtggtggag
aactacaacatcatgggcgtcgccaaggccgcactcgaaagcgctgtccgctatatcgct
gcagagctcggcccgaagggcatccgcgtgcacgccatctctcccggcgctcttgcaacc
cgcgccgcgtcaggcattcccgagttcgatgcgcttctggagaagacgaaggtgaagtcg
ccgacgcgcgagctggtcgacatcgacgacgtcggcgtcgcgacggcatttctcgcgcac
gaggccgcgcggctcatcaccggtcaggtgctctacgttgacggcggctaccacatcatc
gactga

DBGET integrated database retrieval system