KEGG   Sinorhizobium americanum: SAMCFNEI73_Ch2548Help
Entry
SAMCFNEI73_Ch2548 CDS       T04621                                 

Gene name
mdeA
Definition
(GenBank) methionine gamma-lyase MdeA
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
same  Sinorhizobium americanum
Pathway
same00270  Cysteine and methionine metabolism
same00450  Selenocompound metabolism
same01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:same00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAMCFNEI73_Ch2548 (mdeA)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SAMCFNEI73_Ch2548 (mdeA)
Enzymes [BR:same01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     SAMCFNEI73_Ch2548 (mdeA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Met_gamma_lyase UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: APG91826
UniProt: A0A1L3LP47
LinkDB All DBs
Position
2550013..2551296
Genome map
AA seq 427 aa AA seqDB search
MTAPHPSKTHIGNHKLHPETLMLNYGYDPELSEGAVKPPVFLTSTFVFHSAEEGRDFFDF
VSGRREPPAGVGAGLVYSRFNHPNSEIVEDRLAIYERAEAGALFSSGMSAIATTLLAVVR
PGDAILHSQPLYGGTETLLAKTFLNLGIHAVGFADGVDEAAVSAAAEEAMSRGRVAAILV
ETPANPTNSLVDVAMIRRIAEKIGERQGQRPIVACDNTLLGPVFQHPIDHGADLSLYSLT
KYVGGHSDLIAGAVLGSKALIKQVKALRGSIGTQLDPHSCWMLGRSLETLSVRMEKANEN
ARIVAEFLRDHPKVEGIHYLPFHDEASPVGRTFAAQCTGAGSTFSFDIAGGQEAAFRFLN
ALQIFKLAVSLGGTESLASHPAAMTHSGVPIEVRRRIGVLESTIRLSIGIEHPDDLVADV
ANALTTV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccgcatccgtcgaagacccatatcggcaaccacaaactgcatcccgaaacg
ctgatgctgaactacggctacgaccccgagctctcggaaggcgccgtcaagccgccggtg
ttcctcacctccaccttcgtcttccactccgccgaggaaggccgcgacttcttcgatttc
gtctcggggcggcgcgagccgccggcgggcgtcggtgccgggctcgtctattcccgtttc
aatcacccgaacagcgagatcgtcgaggatcggcttgccatatacgaacgggccgaagcc
ggcgcgctcttctcctccggcatgtcggcaattgccacgacgctgcttgccgttgtccgg
cccggcgacgcaatcctgcattcgcagccgctctacggcggcaccgagacgctgctcgcc
aagacctttctgaacctcggcatccatgcggtcggttttgccgacggcgtggacgaagcg
gccgtcagcgccgccgccgaggaggccatgagcaggggccgggtcgccgccatcctcgtc
gaaacgccggccaatcccaccaacagcctcgtcgacgtcgcgatgatccgccgcattgcc
gaaaaaatcggcgaaagacaggggcaaaggccgatcgtcgcctgcgacaacaccctgctc
ggcccggtcttccagcacccgatcgaccatggcgccgacctgtcgctctattcgctcacc
aaatatgtcggcggccactccgatctgatcgccggcgccgtgctgggctcaaaggcgctc
atcaaacaggtgaaggcgcttcgcggctcgatcggcacgcagctcgacccgcattcctgc
tggatgctcggccgctcgctcgaaacgctgtcggtccggatggagaaggcgaacgagaat
gcccgcatcgtcgccgaattcctgcgcgaccacccaaaagtcgaagggatccactatctg
cccttccacgacgaagcctcgccggtcgggcggacctttgccgcgcaatgcaccggcgcc
ggctcgaccttctcgttcgacatcgccggcggccaggaggcagccttccgcttcttgaac
gccctgcagatcttcaagctcgcggtcagcctcggcggcacggaatcgcttgcgagccac
ccggccgcgatgactcattcgggcgtgccgatcgaggtgcggcgccggatcggcgtgctc
gaatcgaccatccgcctgtcgatcggcatcgagcatccggacgacctggtcgccgatgtt
gcgaacgcgctgacgactgtgtga

DBGET integrated database retrieval system