KEGG   Sinorhizobium americanum: SAMCFNEI73_Ch2649Help
Entry
SAMCFNEI73_Ch2649 CDS       T04621                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
same  Sinorhizobium americanum
Pathway
same00010  Glycolysis / Gluconeogenesis
same00620  Pyruvate metabolism
same01100  Metabolic pathways
same01110  Biosynthesis of secondary metabolites
same01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:same00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMCFNEI73_Ch2649 (acoD)
   00620 Pyruvate metabolism
    SAMCFNEI73_Ch2649 (acoD)
Enzymes [BR:same01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SAMCFNEI73_Ch2649 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: APG91925
UniProt: A0A1L3LPC2
LinkDB All DBs
Position
complement(2653057..2654667)
Genome map
AA seq 536 aa AA seqDB search
MALPAAAALYRKSLFGPTLPSTANWSAVFPREEAMLHQKILDNPFKHKYGNFIGGEWREP
VAGRYFDNTTPVTGGTLCQVARSDAADIERALDAAHAAKEKWGRTSTTERSNILMKIAAR
MEDNLALLARAETWDNGKPIRETMAADIPLAVDHFRYFAACIRAQEGSIGEVDHDTVAYH
FHEPLGVVGQIIPWNFPILMAAWKVAPALAAGNCVVLKPAEQTPASILVLAELIADLLPP
GVLNIVNGFGLEAGKPLATSPRIAKIAFTGETTTGRLIMQYASQNLIPVTLELGGKSPNI
FFADVLNEDDDYFDKALEGFAMFALNQGEVCTCPSRVLIQESIYDRFIEGAVKRVEAIRQ
GNPLDSATMIGAQASSEQLEKILAYIDIGKQEGAEVLAGGGRNELGGELSGGYYVKPTVF
RGHNRMRIFQEEIFGPVVSVTTFKTEDEALEIANDTLYGLGAGVWSRDANRCYRFGREIQ
AGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKNMLVSYSPKALGFF
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcattgccggctgccgcggcgctctatcggaaatccctgttcggccccacccttcct
tccacagcaaattggagtgctgtttttccaagggaggaagccatgctgcatcagaagatt
ctcgataacccgttcaagcacaaatacggaaacttcatcggcggtgaatggcgcgagccg
gtggccggacgttatttcgacaataccacgcccgtcaccggcggcacgctctgccaggtg
gcccgctcggatgcagccgatatcgaacgcgcgctcgatgccgcccatgccgccaaggag
aagtggggccggacctcgacgaccgagcgctccaacatcctgatgaagatcgcggcgcgg
atggaggacaatctcgcgctgctggcgcgggccgagacctgggacaacggcaagccgatc
cgcgagacgatggccgccgacatccccttggcggtcgatcatttccgctacttcgccgcc
tgcatccgtgcgcaggaagggtcaatcggcgaggtcgatcacgatacggtcgcctatcat
ttccacgagccgctcggcgtcgtcggccagatcatcccctggaacttcccgatcctgatg
gccgcctggaaggtggcgccggcgcttgcggcaggcaactgcgtcgtgctgaagccggcc
gagcagacgccggcctcgatcctcgttctcgccgaactcatagccgacctgttgccgccg
ggcgtgctcaacatcgtcaacggcttcgggctcgaggccggcaagccgctggcgaccagc
ccgcgcatcgccaagatcgcctttaccggcgagacgacgaccgggcggctgatcatgcaa
tatgccagccagaacctcatcccggtgacgctcgagctcggcggcaagtcgccaaacatc
ttctttgccgacgtgctcaacgaggacgacgactatttcgacaaggcgctcgaaggcttc
gccatgttcgcgctcaaccagggcgaggtctgcacctgcccgagtcgtgtcctgatccag
gaaagcatctacgaccgcttcatcgagggtgccgtgaagcgggtggaggcgatccgccag
ggcaatccgctcgatagcgcgacgatgatcggcgcccaggcgtcgagcgaacagctggaa
aaaatccttgcctatatcgacattggcaagcaggagggcgccgaagtcctggccggcggc
gggcgcaacgagcttgggggcgagctctccggcggctattacgtcaagccgacagtgttc
cgcggacataacaggatgcgcatcttccaggaggaaatcttcggccccgtcgtgtcggtg
acgaccttcaagaccgaggacgaggcgcttgagatcgccaatgacacgctctacggcctc
ggggccggtgtctggagccgcgatgccaaccgctgctaccgtttcggacgcgagatccaa
gccggccgcgtctggaccaactgctaccatgcctatccggcgcatgccgccttcggcggc
tacaagcaatcgggtatcggccgcgagacgcacaagatgatgctcgaccattaccagcag
accaagaacatgctggtgagctacagcccgaaggcgctcggcttcttctga

DBGET integrated database retrieval system