KEGG   Sinorhizobium americanum: SAMCFNEI73_Ch2697Help
Entry
SAMCFNEI73_Ch2697 CDS       T04621                                 

Definition
(GenBank) thymidine kinase Tdk
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
same  Sinorhizobium americanum
Pathway
same00240  Pyrimidine metabolism
same01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:same00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAMCFNEI73_Ch2697
Enzymes [BR:same01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SAMCFNEI73_Ch2697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: APG91973
UniProt: A0A1L3LPM1
LinkDB All DBs
Position
complement(2703336..2703923)
Genome map
AA seq 195 aa AA seqDB search
MAKLYFSYATMNAGKSTLLLQAAYNYQERGMRVVMLIAAFDDRGGMGRIASRIGLQSEGI
PFHGKDDLFKLVERLNGDGSGEIACVFVDEAQFLGQDQVWQLARVADRLGIPVMAYGLRT
DFQGKLFPGSMALLAIADELREVRTICHCGRKATMVVRLDGNGKVMREGAQVDVGGNEKY
VSYCRRHWEDEMRDG
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggccaaactctatttcagctacgcgacgatgaatgcgggcaagagcacgctgctcctg
caggccgcatacaactatcaggagcgtggcatgcgcgtcgtgatgctgatcgccgccttc
gacgatcgcggcggcatggggcgcatcgcatcgcgcatcgggcttcaatcggaaggaatc
ccgttccatgggaaggatgacctttttaaactcgtcgagcggctgaacggcgacggttcc
ggcgagatcgcctgtgtcttcgtcgacgaggcgcagttcctcggccaggaccaggtgtgg
cagcttgcacgcgtcgccgatcgcctcggcatcccggtcatggcttatggcctgagaacg
gatttccaggggaagctctttccgggttccatggcgctgctggcgatcgccgacgagctg
cgcgaggtcaggacgatctgccattgcggacgcaaggcgacgatggtcgtgcgcctcgac
ggcaacggcaaggtcatgcgcgagggggcgcaggtcgatgtcggcggcaatgagaaatac
gtctcctactgccgccgccattgggaagacgagatgcgcgacggctga

DBGET integrated database retrieval system