KEGG   Sinorhizobium americanum: SAMCFNEI73_Ch3460Help
Entry
SAMCFNEI73_Ch3460 CDS       T04621                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase GlpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
same  Sinorhizobium americanum
Pathway
same00564  Glycerophospholipid metabolism
same01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:same00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SAMCFNEI73_Ch3460 (glpD)
Enzymes [BR:same01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SAMCFNEI73_Ch3460 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored FAD_binding_3 FAD_binding_2 NAD_binding_8 GIDA K_oxygenase 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: APG92713
UniProt: A0A1L3LRM9
LinkDB All DBs
Position
3488029..3489546
Genome map
AA seq 505 aa AA seqDB search
MSEQAIFDVFVIGGGINGCGIARDAAGRGYSVALAEMDDFASGTSSGSTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPMRFVLPYHKGGLRPAWLIRLGLFLYDHIGGRKL
LPATSTLDMTRDPAAAPLKRLFTKAFEYSDGWVDDARLVVLNARDAADRGARIMARTRVV
SARRDNGRWAIETEDALTGKRETVRARLLVNATGPWVDRVLADAIGKNDVHNVRLVQGSH
IVVKKKFDDPRAYFFQNPDGRIMFAIPYQDDFTLIGTTDRDFTGNPAEVRISDAEIDYLC
RSASEYFSDPVTKDDIVWTYSAVRPLYDDGASKAQEATRDYVLRLEGENGQAPLLNIFGG
KLTTYRRLAESALEKIGEAIGIKGSKWTAGSHLPGGDFPAAGYDAEVAKLKTHYPFLAAS
HARRLVRLYGTRAKQLLDNAASEADLGRRFGADLYAAEVDWLIAHEWALRAEDVLWRRTK
LGLKLSRAETAELEEYMRDAASAAA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcaggcaatcttcgacgtctttgtcataggcggcggcatcaacggatgcggc
attgcgcgtgatgcggccggccggggatattcggtcgcccttgccgaaatggacgacttc
gcctccggcacctcgtccggctccaccaagctcattcatggcggcctgcgctatctcgag
cattacgagttccggctggtgcgcgaggcgctgatggagcgcgaggtgctctgggcaatg
gcgccgcatgtcatctggccgatgcgcttcgttctgccctatcacaagggcggcctgcgg
ccggcctggctgatccgcctcggcctctttctctacgaccatatcggcggccgcaagctg
ctgccggcgacgagcacgctggacatgacccgcgatccggccgccgcaccgctgaagcgt
ctcttcaccaaggccttcgaatattccgacggctgggtagacgacgcccggctggtggtg
ctgaacgcccgcgatgccgccgaccggggcgcaaggattatggcccgcacccgcgtcgtc
tcggcccgccgcgacaacggtcgctgggcgattgagaccgaggacgcgcttaccggcaag
cgcgaaaccgtacgcgcccgcctgctcgtcaatgccaccggcccctgggtagaccgggtg
ctcgccgatgcgatcggcaagaacgacgtccacaatgtccgcctagtccagggcagccac
atcgtcgtgaagaaaaagttcgacgatccgcgcgcctatttcttccagaacccggacggg
cggatcatgttcgccattccctaccaggacgatttcaccctgatcggcaccaccgaccgg
gatttcaccggcaatccggccgaggtgcgcatcagcgacgccgagatcgattatctctgc
agatcggcaagtgagtatttcagcgatccggtgacgaaggacgacatcgtctggacctat
tcggcggttcgcccgctctatgacgatggcgcaagcaaggcgcaggaagcgacgcgcgac
tatgtgctgcgcctcgaaggtgagaacggccaggcgccgctcctcaatatcttcggcggc
aagctcacgacctaccggcggctggccgaatcggcgcttgagaagatcggcgaggcgatc
ggcataaagggtagcaagtggaccgccggatcgcatctgccgggcggcgactttccggct
gccggttacgatgccgaggtcgccaagttgaagacgcactatccctttctggccgcttcg
catgcccggcgtctggtgcgcctctatggcacgcgcgcgaaacagcttctcgacaatgcc
gcaagcgaggccgatctcggacgacgcttcggtgccgatctctatgcggccgaggtcgat
tggctcatcgcgcatgaatgggcattgcgcgcggaggacgtgctttggcgccgaacaaag
ctgggcctgaagctgtcgcgggcggaaaccgcggaactggaggaatacatgcgggacgcg
gccagcgccgccgcctga

DBGET integrated database retrieval system