KEGG   Sinorhizobium americanum: SAMCFNEI73_pB0463
Entry
SAMCFNEI73_pB0463 CDS       T04621                                 

Definition
(GenBank) 2-hydroxymuconic semialdehyde hydrolase
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
same  Sinorhizobium americanum
Pathway
same00362  Benzoate degradation
same00622  Xylene degradation
same00643  Styrene degradation
same01100  Metabolic pathways
same01120  Microbial metabolism in diverse environments
same01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:same00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAMCFNEI73_pB0463
   00622 Xylene degradation
    SAMCFNEI73_pB0463
   00643 Styrene degradation
    SAMCFNEI73_pB0463
Enzymes [BR:same01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     SAMCFNEI73_pB0463
SSDB
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 LIDHydrolase Ser_hydrolase Peptidase_S15
Other DBs
NCBI-ProteinID: APG93659
UniProt: A0A1L3LU90
LinkDB
Position
B:complement(516593..517417)
AA seq 274 aa
MPLFEDLEFSIDGHRVAYIEGGKGYPLLMIHGSGPGASTLGNWSRVLGPLSERYHVHAMD
LIGFGKSDRKKSEPFFDLDLWIRQCKAMLAKIPGEKVGIIAHSISASLALQVAASESRVG
QVLTTGAMGAKFTVNEGTVACWTFPETRADLKKAIGFLINDKSLIDDAYLDARVKVLHED
PTYKDYFSRMFAGDRQRYADQAIIDPSVLARIKCPVTMLHGRVDEPFPPATTLKLADHIP
QADVVLLANCSHSVALERTDALLSAAHTLFPQPQ
NT seq 825 nt   +upstreamnt  +downstreamnt
atgcctctttttgaagacctagagttctcgattgacggccatcgggtcgcctacatcgaa
ggcggcaagggatatcccctgctgatgatccacggatccgggcctggtgcatcgacattg
gggaactggagccgggtcctcggacccctgtccgagcgatatcatgtccatgcaatggat
ctgatcggtttcggcaagtcggaccgtaagaaatcggagcccttcttcgatctcgatctc
tggattcggcaatgcaaggcgatgctggcaaaaatccccggtgaaaaggtcggaattatc
gcacattccatttcagcgtcgctcgccctgcaggtcgccgcatctgaaagccgcgtcggt
caagtcctgaccaccggggccatgggtgcgaaattcacggtcaacgaaggtacggtcgcc
tgctggacgtttccggaaacccgggcggatcttaagaaagcgatcgggttcctgatcaac
gacaaatcgctgatcgacgatgcctatctggacgcacgggtaaaggtcctccatgaggat
cccacctacaaggactacttttcgcgcatgtttgccggcgatcggcagcgctatgccgat
caagccatcatcgacccttcggtgctggcccgcatcaaatgtccagtgacgatgctgcac
gggagagtggacgaaccattcccgccagcgaccactctcaaacttgccgaccacataccg
caagcggacgtcgtcctgctcgcaaactgctctcactcagtggcgcttgagcgaacggac
gcgcttttgtccgccgctcatacgctcttcccgcaaccacaataa

DBGET integrated database retrieval system